Macaca mulatta (rhesus monkey): 705671 Help Entry 705671            CDS       T01028                                  Name (RefSeq) actin, cytoplasmic 2-like   KO K05692   actin beta/gamma 1 Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc03082   ATP-dependent chromatin remodeling mcc04015   Rap1 signaling pathway mcc04145   Phagosome mcc04210   Apoptosis mcc04390   Hippo signaling pathway mcc04510   Focal adhesion mcc04520   Adherens junction mcc04530   Tight junction mcc04611   Platelet activation mcc04613   Neutrophil extracellular trap formation mcc04670   Leukocyte transendothelial migration mcc04714   Thermogenesis mcc04810   Regulation of actin cytoskeleton mcc04814   Motor proteins mcc04820   Cytoskeleton in muscle cells mcc04919   Thyroid hormone signaling pathway mcc04921   Oxytocin signaling pathway mcc04971   Gastric acid secretion mcc05014   Amyotrophic lateral sclerosis mcc05100   Bacterial invasion of epithelial cells mcc05132   Salmonella infection mcc05135   Yersinia infection mcc05164   Influenza A mcc05205   Proteoglycans in cancer mcc05225   Hepatocellular carcinoma mcc05410   Hypertrophic cardiomyopathy mcc05412   Arrhythmogenic right ventricular cardiomyopathy mcc05414   Dilated cardiomyopathy mcc05416   Viral myocarditis mcc05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mcc00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     705671  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     705671    04390 Hippo signaling pathway     705671  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     705671   09143 Cell growth and death    04210 Apoptosis     705671   09144 Cellular community - eukaryotes    04510 Focal adhesion     705671    04520 Adherens junction     705671    04530 Tight junction     705671   09142 Cell motility    04814 Motor proteins     705671    04820 Cytoskeleton in muscle cells     705671    04810 Regulation of actin cytoskeleton     705671  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     705671    04613 Neutrophil extracellular trap formation     705671    04670 Leukocyte transendothelial migration     705671   09152 Endocrine system    04921 Oxytocin signaling pathway     705671    04919 Thyroid hormone signaling pathway     705671   09154 Digestive system    04971 Gastric acid secretion     705671   09159 Environmental adaptation    04714 Thermogenesis     705671  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     705671   09162 Cancer: specific types    05225 Hepatocellular carcinoma     705671   09172 Infectious disease: viral    05164 Influenza A     705671   09171 Infectious disease: bacterial    05132 Salmonella infection     705671    05135 Yersinia infection     705671    05100 Bacterial invasion of epithelial cells     705671   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     705671   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     705671    05410 Hypertrophic cardiomyopathy     705671    05412 Arrhythmogenic right ventricular cardiomyopathy     705671    05414 Dilated cardiomyopathy     705671    05416 Viral myocarditis     705671  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:mcc03021]     705671    03019 Messenger RNA biogenesis [BR:mcc03019]     705671    03036 Chromosome and associated proteins [BR:mcc03036]     705671    03029 Mitochondrial biogenesis [BR:mcc03029]     705671   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mcc04812]     705671    04147 Exosome [BR:mcc04147]     705671 Transcription machinery [BR:mcc03021]  Eukaryotic type   RNA polymerase II system    Coactivators     BAF/PBAF complex      705671 Messenger RNA biogenesis [BR:mcc03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      705671 Chromosome and associated proteins [BR:mcc03036]  Eukaryotic type   Histone modification proteins    HAT complexes     TIP60 complex      705671     NuA4 complex      705671   Chromatin remodeling factors    BAF complex     705671    PBAF complex     705671    GBAF(ncBAF) complex     705671    SWR1 complex     705671 Mitochondrial biogenesis [BR:mcc03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Actin cytoskeleton organization     705671 Cytoskeleton proteins [BR:mcc04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actins     Actins      705671 Exosome [BR:mcc04147]  Exosomal proteins   Proteins found in most exosomes    705671 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Actin Motif Other DBs NCBI-GeneID:  705671 NCBI-ProteinID:  XP_028700214 LinkDB All DBs Position 2:complement(133462315..133463984) Genome browser AA seq 332 aa AA seqDB search MVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPV LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTV PIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDF EQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIM KCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGG SILASLSTFQQMWISKQEYDESGPSIVHRKCF NT seq 999 nt NT seq  +upstreamnt  +downstreamnt atggtgggcatgggtcagaaggattcatatgtgggcgacgaggcccagagcaagagaggc attctcaccctgaagtaccccatcgagcacggcatcgtcaccaactgggacgacatggag aagatctggcaccacaccttctacaatgagctgcgtgtggctcctgaggagcaccccgtg ctgctgaccgaggcccccctgaaccccaaggccaaccgcgagaagatgacccagatcatg tttgagaccttcaacaccccagccatgtacgtggccatccaggctgtgctgtccctgtac gcctctggccgtaccactggcatcgtgatggactccggtgacggggtcacccacactgtg cccatctacgaggggtatgccctcccccatgccatcctgcgtctggacctggctggccgg gacctgactgactacctcatgaagatcctcactgagcgcggctacagcttcaccaccacg gccgagcgggaaatcgtgcgtgacattaaggagaagctgtgctatgtcgccctagacttc gagcaggagatggccacggcggcttccagctcctccctggagaagagctacgagctgccc gatggccaggtcatcaccattggcaacgagcggttccgctgccctgaggctctcttccaa ccttccttcctgggcatggagtcctgtggcatccacgaaactaccttcaactccatcatg aagtgtgacgtggacatccgtaaagacctgtacgccaacacagtgctgtctggtggcacc accatgtaccctggcattgctgacaggatgcagaaggagattactgccctggcgcccagc acgatgaagatcaagatcattgctcctcctgagcgcaagtactctgtgtggatcggcggc tccatcctggcctcgctgtccaccttccagcagatgtggatcagcaagcaggagtatgac gagtctggcccttccatcgtccaccgcaaatgcttctag

DBGET integrated database retrieval system