Macaca mulatta (rhesus monkey): 716170 Help Entry 716170            CDS       T01028                                  Symbol TP53 Name (RefSeq) cellular tumor antigen p53   KO K04451   tumor protein p53 Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc01522   Endocrine resistance mcc01524   Platinum drug resistance mcc04010   MAPK signaling pathway mcc04071   Sphingolipid signaling pathway mcc04110   Cell cycle mcc04115   p53 signaling pathway mcc04137   Mitophagy - animal mcc04151   PI3K-Akt signaling pathway mcc04210   Apoptosis mcc04211   Longevity regulating pathway mcc04216   Ferroptosis mcc04218   Cellular senescence mcc04310   Wnt signaling pathway mcc04722   Neurotrophin signaling pathway mcc04919   Thyroid hormone signaling pathway mcc05012   Parkinson disease mcc05014   Amyotrophic lateral sclerosis mcc05016   Huntington disease mcc05160   Hepatitis C mcc05161   Hepatitis B mcc05162   Measles mcc05163   Human cytomegalovirus infection mcc05165   Human papillomavirus infection mcc05166   Human T-cell leukemia virus 1 infection mcc05167   Kaposi sarcoma-associated herpesvirus infection mcc05168   Herpes simplex virus 1 infection mcc05169   Epstein-Barr virus infection mcc05200   Pathways in cancer mcc05202   Transcriptional misregulation in cancer mcc05203   Viral carcinogenesis mcc05205   Proteoglycans in cancer mcc05206   MicroRNAs in cancer mcc05210   Colorectal cancer mcc05212   Pancreatic cancer mcc05213   Endometrial cancer mcc05214   Glioma mcc05215   Prostate cancer mcc05216   Thyroid cancer mcc05217   Basal cell carcinoma mcc05218   Melanoma mcc05219   Bladder cancer mcc05220   Chronic myeloid leukemia mcc05222   Small cell lung cancer mcc05223   Non-small cell lung cancer mcc05224   Breast cancer mcc05225   Hepatocellular carcinoma mcc05226   Gastric cancer mcc05230   Central carbon metabolism in cancer mcc05417   Lipid and atherosclerosis mcc05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mcc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     716170 (TP53)    04310 Wnt signaling pathway     716170 (TP53)    04071 Sphingolipid signaling pathway     716170 (TP53)    04151 PI3K-Akt signaling pathway     716170 (TP53)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     716170 (TP53)   09143 Cell growth and death    04110 Cell cycle     716170 (TP53)    04210 Apoptosis     716170 (TP53)    04216 Ferroptosis     716170 (TP53)    04115 p53 signaling pathway     716170 (TP53)    04218 Cellular senescence     716170 (TP53)  09150 Organismal Systems   09152 Endocrine system    04919 Thyroid hormone signaling pathway     716170 (TP53)   09156 Nervous system    04722 Neurotrophin signaling pathway     716170 (TP53)   09149 Aging    04211 Longevity regulating pathway     716170 (TP53)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     716170 (TP53)    05202 Transcriptional misregulation in cancer     716170 (TP53)    05206 MicroRNAs in cancer     716170 (TP53)    05205 Proteoglycans in cancer     716170 (TP53)    05203 Viral carcinogenesis     716170 (TP53)    05230 Central carbon metabolism in cancer     716170 (TP53)   09162 Cancer: specific types    05210 Colorectal cancer     716170 (TP53)    05212 Pancreatic cancer     716170 (TP53)    05225 Hepatocellular carcinoma     716170 (TP53)    05226 Gastric cancer     716170 (TP53)    05214 Glioma     716170 (TP53)    05216 Thyroid cancer     716170 (TP53)    05220 Chronic myeloid leukemia     716170 (TP53)    05217 Basal cell carcinoma     716170 (TP53)    05218 Melanoma     716170 (TP53)    05219 Bladder cancer     716170 (TP53)    05215 Prostate cancer     716170 (TP53)    05213 Endometrial cancer     716170 (TP53)    05224 Breast cancer     716170 (TP53)    05222 Small cell lung cancer     716170 (TP53)    05223 Non-small cell lung cancer     716170 (TP53)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     716170 (TP53)    05161 Hepatitis B     716170 (TP53)    05160 Hepatitis C     716170 (TP53)    05162 Measles     716170 (TP53)    05168 Herpes simplex virus 1 infection     716170 (TP53)    05163 Human cytomegalovirus infection     716170 (TP53)    05167 Kaposi sarcoma-associated herpesvirus infection     716170 (TP53)    05169 Epstein-Barr virus infection     716170 (TP53)    05165 Human papillomavirus infection     716170 (TP53)   09164 Neurodegenerative disease    05012 Parkinson disease     716170 (TP53)    05014 Amyotrophic lateral sclerosis     716170 (TP53)    05016 Huntington disease     716170 (TP53)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     716170 (TP53)    05418 Fluid shear stress and atherosclerosis     716170 (TP53)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     716170 (TP53)    01522 Endocrine resistance     716170 (TP53)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:mcc03000]     716170 (TP53)    03036 Chromosome and associated proteins [BR:mcc03036]     716170 (TP53)    03400 DNA repair and recombination proteins [BR:mcc03400]     716170 (TP53) Transcription factors [BR:mcc03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    p53     716170 (TP53) Chromosome and associated proteins [BR:mcc03036]  Eukaryotic type   Sister chromatid separation proteins    Aurora kinases     Regulators of Aurora kinases      716170 (TP53) DNA repair and recombination proteins [BR:mcc03400]  Eukaryotic type   Check point factors    Other check point factors     716170 (TP53) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  P53 P53_tetramer TAD2 P53_TAD Motif Other DBs NCBI-GeneID:  716170 NCBI-ProteinID:  NP_001040616 Ensembl:  ENSMMUG00000008639 UniProt:  P56424 E3U906 A0A8J8XH32 LinkDB All DBs Position 16:complement(7447315..7466507) Genome browser AA seq 393 aa AA seqDB search MEEPQSDPSIEPPLSQETFSDLWKLLPENNVLSPLPSQAVDDLMLSPDDLAQWLTEDPGP DEAPRMSEAAPPMAPTPAAPTPAAPAPAPSWPLSSSVPSQKTYHGSYGFRLGFLHSGTAK SVTCTYSPDLNKMFCQLAKTCPVQLWVDSTPPPGSRVRAMAIYKQSQHMTEVVRRCPHHE RCSDSDGLAPPQHLIRVEGNLRVEYSDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENFRKKGEPCHQLP PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPA GSRAHSSHLKSKKGQSTSRHKKFMFKTEGPDSD NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt atggaggagccgcagtcagatcctagcatcgagccccctctgagtcaggaaacattttca gacctatggaaactacttcctgaaaacaacgttctgtcccccttgccgtcccaagcagtg gatgatttgatgctgtctccagacgatcttgcacaatggttaactgaagacccaggtcca gatgaagctccgagaatgtcagaggctgctccccccatggcccccacaccagcagctcct acaccggcggcccctgcaccagccccctcctggcccctgtcatcctctgtcccttcccag aaaacctaccatggcagctacggtttccgtctgggcttcctgcattctggaacagccaag tctgtgacttgcacgtactcccctgacctcaacaagatgttttgccagctggccaagacc tgccccgtgcagctatgggttgattccacacccccacccggcagccgcgtccgcgccatg gccatctacaagcagtcacagcacatgacggaggtcgtgaggcgctgcccccaccatgag cgctgctcagacagcgatggactggcccctcctcagcaccttatccgagtggaaggaaat ttgcgtgtggagtattcggatgacagaaacacttttcgacatagtgtggtggtgccctat gagccgcctgaggttggctctgactgtaccaccatccactacaactacatgtgtaacagt tcctgcatgggcggcatgaaccggaggcccatccttaccattatcacactggaagactcc agtggtaatctactgggacggaacagctttgaggtgcgagtttgtgcctgtcctgggaga gaccggcgcacagaggaagagaatttccgcaagaaaggggagccttgccaccagctgccc cctgggagcactaagcgagcactgcccaacaacaccagctcctctccccagccaaagaag aaaccactggatggagaatatttcacccttcagatccgtgggcgtgagcgcttcgagatg ttccgagagctgaatgaggccttggaactcaaggatgcccaggctgggaaagagccagcg gggagcagggctcactccagccacctgaagtccaagaaggggcaatctacctcccgccat aaaaaattcatgttcaagacagaggggcctgactcagactga

DBGET integrated database retrieval system