Macaca mulatta (rhesus monkey): 718171 Help Entry 718171            CDS       T01028                                  Symbol RAP1B Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04010   MAPK signaling pathway mcc04014   Ras signaling pathway mcc04015   Rap1 signaling pathway mcc04024   cAMP signaling pathway mcc04062   Chemokine signaling pathway mcc04510   Focal adhesion mcc04517   IgSF CAM signaling mcc04520   Adherens junction mcc04611   Platelet activation mcc04670   Leukocyte transendothelial migration mcc04720   Long-term potentiation mcc04722   Neurotrophin signaling pathway mcc04934   Cushing syndrome mcc04972   Pancreatic secretion mcc05211   Renal cell carcinoma mcc05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mcc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     718171 (RAP1B)    04014 Ras signaling pathway     718171 (RAP1B)    04015 Rap1 signaling pathway     718171 (RAP1B)    04024 cAMP signaling pathway     718171 (RAP1B)   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     718171 (RAP1B)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     718171 (RAP1B)    04520 Adherens junction     718171 (RAP1B)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     718171 (RAP1B)    04670 Leukocyte transendothelial migration     718171 (RAP1B)    04062 Chemokine signaling pathway     718171 (RAP1B)   09154 Digestive system    04972 Pancreatic secretion     718171 (RAP1B)   09156 Nervous system    04720 Long-term potentiation     718171 (RAP1B)    04722 Neurotrophin signaling pathway     718171 (RAP1B)  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     718171 (RAP1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     718171 (RAP1B)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     718171 (RAP1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mcc04147]     718171 (RAP1B)    04031 GTP-binding proteins [BR:mcc04031]     718171 (RAP1B) Exosome [BR:mcc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    718171 (RAP1B)   Exosomal proteins of other body fluids (saliva and urine)    718171 (RAP1B)   Exosomal proteins of colorectal cancer cells    718171 (RAP1B) GTP-binding proteins [BR:mcc04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     718171 (RAP1B) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha Motif Other DBs NCBI-GeneID:  718171 NCBI-ProteinID:  NP_001185607 Ensembl:  ENSMMUG00000011442 UniProt:  I0FTW6 A0A1D5QWX3 LinkDB All DBs Position 11:68145907..68196892 Genome browser AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSS CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgagtataagctagtcgttcttggctcaggaggcgttggaaagtctgctttgact gtacagtttgttcaaggaatttttgtagaaaaatatgatcctacgatagaagattcttat agaaagcaagttgaagtagatgcacaacagtgtatgcttgaaatcttggatactgcagga acggaacaatttacagcaatgagggatttgtacatgaaaaatggacaaggatttgcatta gtttattccatcacagcacagtccacatttaacgatttacaagacctgagagaacagatt cttcgagttaaagacactgatgatgttccgatgattcttgttggtaataagtgtgacttg gaagatgaaagagttgtaggaaaggaacaaggtcaaaatctagcaagacaatggaacaac tgtgcattcttagaatcttctgcaaaatcaaaaataaatgttaatgagatcttttatgac ctagtgcggcaaattaacagaaaaactccagtgcctgggaaggctcgcaaaaagtcatca tgtcagctgctttaa

DBGET integrated database retrieval system