Melitaea cinxia (Glanville fritillary): 123658111 Help Entry 123658111         CDS       T09237                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism mcix  Melitaea cinxia (Glanville fritillary) Pathway mcix00510   N-Glycan biosynthesis mcix00513   Various types of N-glycan biosynthesis mcix04141   Protein processing in endoplasmic reticulum Module mcix_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:mcix00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     123658111    00513 Various types of N-glycan biosynthesis     123658111  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     123658111 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 DUF6512 TctB CAAD Pox_E2-like Pestivirus_E2 Motif Other DBs NCBI-GeneID:  123658111 NCBI-ProteinID:  XP_045449534 LinkDB All DBs Position 11:2410761..2411312 Genome browser AA seq 81 aa AA seqDB search MSLEIESMVRYASPINPAVFPHLTMLLLGIGIFFTAWFFVYEVTSTKASRDLFKELLLSL VAALFSGFGILFLLLWVGIYV NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgagcttggaaatcgagtcaatggtgcgatatgcctcgcctatcaacccggcagtgttc ccacatcttacgatgctgttacttggtattgggatattcttcacggcgtggttcttcgtc tacgaggtgacaagcactaaagcatccagagacctgttcaaggaacttttgctctcatta gtagccgccttgttctctggattcggaatcctctttttattattatgggtaggcatatac gtctga

DBGET integrated database retrieval system