KEGG   Macrococcus caseolyticus: MCCL_1121
Entry
MCCL_1121         CDS       T00848                                 
Symbol
hepB2
Name
(GenBank) component B of hexaprenyl diphosphate synthase
  KO
K21275  hexaprenyl-diphosphate synthase large subunit [EC:2.5.1.83]
Organism
mcl  Macrococcus caseolyticus
Pathway
mcl00900  Terpenoid backbone biosynthesis
mcl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mcl00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MCCL_1121 (hepB2)
Enzymes [BR:mcl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.83  hexaprenyl diphosphate synthase [(2E,6E)-farnesyl-diphosphate specific]
     MCCL_1121 (hepB2)
SSDB
Motif
Pfam: polyprenyl_synt
Other DBs
NCBI-ProteinID: BAH17828
UniProt: B9E6L0
LinkDB
Position
complement(1229562..1230539)
AA seq 325 aa
MIAVSYKAFLQPYIYEVEQRLQTLIQSESTVITNASMHILNSGGKRVRPMFVLLSGFLAK
GEKEHLIRTAVSLELIHMASLVHDDYIDNSDKRRGNTSVHMAFNKDTAIRTGHFLLARAL
ENIAEINDSQYHQIFSKTILEVCFGEFDQMADRFNYPITFTEYLRRINRKTAILIEASCH
LGAVSTNLDSYTTYHVKQFGHCIGMSYQIIDDILDYTSDEVTLGKPVGSDIRNGHVTYPL
IAAIDVLNQHEDYRLEQSVMQLQQSSDEAVFDYIIEQVKRYGVHSSEVLSRKYGDKAKFH
LDQLPDSNIKSYLIQIHEKMLKRIY
NT seq 978 nt   +upstreamnt  +downstreamnt
atgattgctgtgagttataaagcatttttacaaccatatatatatgaagtcgaacagaga
ttacagacgttaattcaaagtgaatctacagtgatcaccaatgcctctatgcatatatta
aattctggcggtaaacgcgtgagaccgatgtttgtattgttaagcggatttctagctaag
ggtgaaaaagaacatttgattcgtacagctgtatcgctggaacttatacatatggcaagc
cttgttcatgacgattatatagataatagtgataaacgtagaggtaatacttctgtgcat
atggcttttaacaaggacacagcaattcgaacaggacatttcttattggctcgcgcatta
gagaatattgcagaaattaatgattcacagtatcatcaaatattcagtaaaacaatatta
gaagtttgtttcggtgaatttgatcagatggcagatcgctttaactatccgattacattc
accgagtatttaagacgcattaatcgtaagactgcaattctcattgaagcaagctgtcat
ctgggagctgtgagtacgaatcttgattcatatacaacctatcatgttaagcagttcggg
cactgcattggtatgagctatcagattatcgatgatatcctggattatacaagtgacgaa
gtgacactcggtaaaccggtcggaagtgacatccgaaatgggcacgtcacctacccgctt
atagcagcgattgatgtattaaatcagcatgaagattacagactggaacaaagcgtaatg
caattacagcaatcttcagatgaagcggtatttgattatatcattgaacaggtgaaacga
tatggtgtacattcttcggaagtactgagcagaaaatacggtgataaagcgaaatttcat
ctagatcaactgccagacagtaacatcaaaagctatttaatacaaattcatgaaaaaatg
ttgaaacgtatctattag

DBGET integrated database retrieval system