Musca domestica (house fly): 101897713 Help Entry 101897713         CDS       T03448                                  Name (RefSeq) GTP-binding nuclear protein Ran   KO K07936   GTP-binding nuclear protein Ran Organism mde  Musca domestica (house fly) Pathway mde03008   Ribosome biogenesis in eukaryotes mde03013   Nucleocytoplasmic transport mde03250   Viral life cycle - HIV-1 Brite KEGG Orthology (KO) [BR:mde00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     101897713    03008 Ribosome biogenesis in eukaryotes     101897713   09125 Information processing in viruses    03250 Viral life cycle - HIV-1     101897713  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:mde03019]     101897713    03009 Ribosome biogenesis [BR:mde03009]     101897713    03016 Transfer RNA biogenesis [BR:mde03016]     101897713    03036 Chromosome and associated proteins [BR:mde03036]     101897713   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mde04147]     101897713    04031 GTP-binding proteins [BR:mde04031]     101897713 Messenger RNA biogenesis [BR:mde03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     Ran-mediated transport factors      101897713 Ribosome biogenesis [BR:mde03009]  Eukaryotic type   Pre-40S particles    Export and cytoplasmic maturation factors     101897713   Pre-60S particles     101897713 Transfer RNA biogenesis [BR:mde03016]  Eukaryotic type   tRNA transport factors    tRNA export factors     101897713 Chromosome and associated proteins [BR:mde03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Regulators of centriole replication      101897713    Spindle formation proteins     101897713 Exosome [BR:mde04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101897713 GTP-binding proteins [BR:mde04031]  Small (monomeric) G-proteins   Ran Family    Ran     101897713 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 RNA_helicase GTP_EFTU Gtr1_RagA AAA_24 ArgoMid AAA_7 DUF5935 DUF5906 AAA_16 DAP3 Motif Other DBs NCBI-GeneID:  101897713 NCBI-ProteinID:  XP_005191937 UniProt:  T1PAV1 LinkDB All DBs Position Unknown AA seq 216 aa AA seqDB search MAQPEQDIPTFKCVLVGDGGTGKTTFVKRHMTGEFEKKYVATLGVEVHPLIFHTNRGAIR FNVWDTAGQEKFGGLRDGYYIQGQCAVIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLC GNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLVGDPNLEFVAMP ALLPPEVKMDKDWQLQIERDLQEAQETALPDEDEDL NT seq 651 nt NT seq  +upstreamnt  +downstreamnt atggcacaacccgaacaagatattccaacattcaaatgcgttttggtcggtgacggtggt accggcaagacaacattcgtcaaacgtcacatgactggtgaatttgagaagaaatacgtt gccacactcggtgtcgaggtgcatccattgattttccacacaaatcgtggtgccatccga ttcaacgtctgggatacagctggccaggaaaaattcggtggtttacgtgatggctattac attcagggacagtgtgccgttattatgttcgatgtgacgtcgcgtgttacctacaagaac gtaccaaattggcacagagatttggtgcgtgtgtgcgagaacataccaattgtgttgtgt ggcaataaggtcgacatcaaggatcgcaaggtgaaggccaagagtattgtgttccacaga aagaagaatctacagtactatgacatctcggccaaatcaaattacaattttgagaaacct ttcctttggttggcccgtaaattggttggtgatcccaatttggagtttgtggccatgcca gccttgctgcctccagaagtcaaaatggacaaggactggcaactacaaatcgaaagagat ttgcaggaagcccaagaaaccgctttgcccgacgaggatgaagacttgtaa

DBGET integrated database retrieval system