Microplitis demolitor: 103578781 Help Entry 103578781         CDS       T05600                                  Name (RefSeq) RING-box protein 1A   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism mdl  Microplitis demolitor Pathway mdl03420   Nucleotide excision repair mdl04120   Ubiquitin mediated proteolysis mdl04141   Protein processing in endoplasmic reticulum mdl04310   Wnt signaling pathway mdl04341   Hedgehog signaling pathway - fly mdl04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:mdl00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     103578781    04120 Ubiquitin mediated proteolysis     103578781   09124 Replication and repair    03420 Nucleotide excision repair     103578781  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     103578781    04341 Hedgehog signaling pathway - fly     103578781    04350 TGF-beta signaling pathway     103578781  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:mdl04121]     103578781    03400 DNA repair and recombination proteins [BR:mdl03400]     103578781 Enzymes [BR:mdl01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      103578781 Ubiquitin system [BR:mdl04121]  Ubiquitin ligases (E3)   UBL E3 ligases    103578781   Multi subunit type E3    SCF complex     Ring finger protein      103578781    Cul2 complex      103578781    Cul3 complex      103578781    Cul4 complex      103578781    Cul7 complex      103578781    Cul8 complex      103578781    Cul9 complex      103578781 DNA repair and recombination proteins [BR:mdl03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       103578781     TCR (transcription coupled repair) factors      Cul4-CSA complex       103578781 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 PHD_NSD zf-RING_16 Motif Other DBs NCBI-GeneID:  103578781 NCBI-ProteinID:  XP_008558189 LinkDB All DBs Position Unknown AA seq 114 aa AA seqDB search MASAAMDVDEEEIDMPTSSSGKGDKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCI ECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atggcatcagcagcaatggatgttgacgaggaagaaattgacatgcctacttccagcagt ggaaaaggcgacaaaaaacgtttcgaagtaaaaaagtggaacgcagttgcactttgggcc tgggatattgtcgttgacaattgtgctatttgtagaaaccacataatggatttgtgtatc gagtgccaagcaaatcaagcatcagctacgagcgaggaatgcacagtagcttggggtgtc tgcaatcacgcttttcattttcattgcatttcccgttggcttaaaacacgtcaagtctgt cctcttgataatcgtgagtgggaattccaaaagtacggtcactag

DBGET integrated database retrieval system