Malus domestica (apple): 103427972 Help Entry 103427972         CDS       T03194                                  Name (RefSeq) calcium-binding protein CP1-like   KO K02183   calmodulin Organism mdm  Malus domestica (apple) Pathway mdm04016   MAPK signaling pathway - plant mdm04070   Phosphatidylinositol signaling system mdm04075   Plant hormone signal transduction mdm04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:mdm00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     103427972    04070 Phosphatidylinositol signaling system     103427972    04075 Plant hormone signal transduction     103427972  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     103427972  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mdm01009]     103427972   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mdm04131]     103427972    03036 Chromosome and associated proteins [BR:mdm03036]     103427972   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mdm04147]     103427972 Protein phosphatases and associated proteins [BR:mdm01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      103427972 Membrane trafficking [BR:mdm04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     103427972 Chromosome and associated proteins [BR:mdm03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      103427972 Exosome [BR:mdm04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    103427972 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 DUF7120 DUF1456 Motif Other DBs NCBI-GeneID:  103427972 NCBI-ProteinID:  XP_070677042 LinkDB All DBs Position 04:3964392..3964700 Genome browser AA seq 102 aa AA seqDB search MSAADSDNDGFVQYEEFERVLACGDRAKSSGVMDDVFKVMDKDDDGKLSHEDMKNYMSSA GFVVTDEDIKAMIKLGGGDENQGVTYAGLLKILAVDQVSEAS NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgtctgccgctgattccgacaacgacgggttcgtccagtatgaggagttcgagcgcgtc ttggcttgcggcgacagggcaaaaagctcgggagtgatggatgacgtgtttaaggtgatg gacaaggacgacgacgggaaactcagccacgaggacatgaagaattacatgagcagcgcc ggcttcgtcgtcaccgatgaagatatcaaggccatgattaaactaggcggcggcgatgag aaccaaggcgtgacgtatgctggcttgcttaagatcctggccgttgatcaagtcagcgaa gcgtcttga

DBGET integrated database retrieval system