Entry |
|
Symbol |
RBX1
|
Name |
|
KO |
|
Organism |
mdo Monodelphis domestica (gray short-tailed opossum)
|
Pathway |
mdo04141 | Protein processing in endoplasmic reticulum |
mdo05170 | Human immunodeficiency virus 1 infection |
|
Brite |
KEGG Orthology (KO) [BR:mdo00001]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04141 Protein processing in endoplasmic reticulum
100013521 (RBX1)
04120 Ubiquitin mediated proteolysis
100013521 (RBX1)
09124 Replication and repair
03420 Nucleotide excision repair
100013521 (RBX1)
09130 Environmental Information Processing
09132 Signal transduction
04310 Wnt signaling pathway
100013521 (RBX1)
04350 TGF-beta signaling pathway
100013521 (RBX1)
04066 HIF-1 signaling pathway
100013521 (RBX1)
09140 Cellular Processes
09143 Cell growth and death
04110 Cell cycle
100013521 (RBX1)
04114 Oocyte meiosis
100013521 (RBX1)
09150 Organismal Systems
09159 Environmental adaptation
04710 Circadian rhythm
100013521 (RBX1)
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
100013521 (RBX1)
09162 Cancer: specific types
05211 Renal cell carcinoma
100013521 (RBX1)
09172 Infectious disease: viral
05170 Human immunodeficiency virus 1 infection
100013521 (RBX1)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04121 Ubiquitin system [BR:mdo04121]
100013521 (RBX1)
03400 DNA repair and recombination proteins [BR:mdo03400]
100013521 (RBX1)
Enzymes [BR:mdo01000]
2. Transferases
2.3 Acyltransferases
2.3.2 Aminoacyltransferases
2.3.2.32 cullin-RING-type E3 NEDD8 transferase
100013521 (RBX1)
Ubiquitin system [BR:mdo04121]
Ubiquitin ligases (E3)
UBL E3 ligases
100013521 (RBX1)
Multi subunit type E3
SCF complex
Ring finger protein
100013521 (RBX1)
Cul2 complex
100013521 (RBX1)
Cul3 complex
100013521 (RBX1)
Cul4 complex
100013521 (RBX1)
Cul7 complex
100013521 (RBX1)
Cul8 complex
100013521 (RBX1)
Cul9 complex
100013521 (RBX1)
DNA repair and recombination proteins [BR:mdo03400]
Eukaryotic type
SSBR (single strand breaks repair)
NER (nucleotide excision repair)
GGR (global genome repair) factors
Cul4-DDB2 complex
100013521 (RBX1)
TCR (transcription coupled repair) factors
Cul4-CSA complex
100013521 (RBX1)
|
SSDB |
|
Motif |
|
Other DBs |
|
LinkDB |
|
Position |
8:9986875..9995488
|
AA seq |
108 aa
MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ
ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH |
NT seq |
327 nt +upstreamnt +downstreamnt
atggcggcggcgatggatgtggatacccccagtggcaccaacagcggcgccggcaagaaa
cgctttgaagtgaaaaagtggaatgccgtggccctctgggcctgggatattgtggttgac
aactgtgccatctgcaggaaccacattatggacctttgtatagaatgtcaagccaaccag
gcctcggccacctccgaagaatgtactgttgcctggggagtctgcaatcacgccttccac
ttccactgcatctctcgctggctcaaaacccggcaggtgtgcccgctggacaacagagag
tgggagtttcaaaagtacgggcattag |