Myotis daubentonii (Daubenton's bat): 132212752 Help Entry 132212752         CDS       T10294                                  Symbol IFNB1 Name (RefSeq) interferon beta   KO K05415   interferon beta Organism mdt  Myotis daubentonii (Daubenton's bat) Pathway mdt04060   Cytokine-cytokine receptor interaction mdt04151   PI3K-Akt signaling pathway mdt04217   Necroptosis mdt04380   Osteoclast differentiation mdt04620   Toll-like receptor signaling pathway mdt04621   NOD-like receptor signaling pathway mdt04622   RIG-I-like receptor signaling pathway mdt04623   Cytosolic DNA-sensing pathway mdt04630   JAK-STAT signaling pathway mdt04650   Natural killer cell mediated cytotoxicity mdt04668   TNF signaling pathway mdt04936   Alcoholic liver disease mdt05135   Yersinia infection mdt05142   Chagas disease mdt05152   Tuberculosis mdt05160   Hepatitis C mdt05161   Hepatitis B mdt05162   Measles mdt05163   Human cytomegalovirus infection mdt05164   Influenza A mdt05165   Human papillomavirus infection mdt05167   Kaposi sarcoma-associated herpesvirus infection mdt05168   Herpes simplex virus 1 infection mdt05169   Epstein-Barr virus infection mdt05170   Human immunodeficiency virus 1 infection mdt05171   Coronavirus disease mdt05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mdt00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     132212752 (IFNB1)    04668 TNF signaling pathway     132212752 (IFNB1)    04151 PI3K-Akt signaling pathway     132212752 (IFNB1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     132212752 (IFNB1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     132212752 (IFNB1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     132212752 (IFNB1)    04621 NOD-like receptor signaling pathway     132212752 (IFNB1)    04622 RIG-I-like receptor signaling pathway     132212752 (IFNB1)    04623 Cytosolic DNA-sensing pathway     132212752 (IFNB1)    04650 Natural killer cell mediated cytotoxicity     132212752 (IFNB1)   09158 Development and regeneration    04380 Osteoclast differentiation     132212752 (IFNB1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     132212752 (IFNB1)    05161 Hepatitis B     132212752 (IFNB1)    05160 Hepatitis C     132212752 (IFNB1)    05171 Coronavirus disease     132212752 (IFNB1)    05164 Influenza A     132212752 (IFNB1)    05162 Measles     132212752 (IFNB1)    05168 Herpes simplex virus 1 infection     132212752 (IFNB1)    05163 Human cytomegalovirus infection     132212752 (IFNB1)    05167 Kaposi sarcoma-associated herpesvirus infection     132212752 (IFNB1)    05169 Epstein-Barr virus infection     132212752 (IFNB1)    05165 Human papillomavirus infection     132212752 (IFNB1)   09171 Infectious disease: bacterial    05135 Yersinia infection     132212752 (IFNB1)    05152 Tuberculosis     132212752 (IFNB1)   09174 Infectious disease: parasitic    05142 Chagas disease     132212752 (IFNB1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     132212752 (IFNB1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     132212752 (IFNB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mdt04052]     132212752 (IFNB1) Cytokines and neuropeptides [BR:mdt04052]  Cytokines   Interferons    132212752 (IFNB1) SSDB OrthologParalogGFIT Motif Pfam:  Interferon KAR9 AAA_lid_11 E3_UbLigase_R4 LRR_9 Tsc35 DUF7605 Motif Other DBs NCBI-GeneID:  132212752 NCBI-ProteinID:  XP_059514731 LinkDB All DBs Position 11:19774725..19775465 Genome browser AA seq 186 aa AA seqDB search MTNRCPLQLTVLLCLAGAALSVNYSELRLRQKSSNSACQQLLWQLIKSPQHCLDDRMDFQ IPKQVEQPQEFRKEEAMVVMYEMLQQIHSISRRNFSNAGWNETIVENLQEELDEQMDGLE KALEEIKQEGKFPWESRTVLRLKTYYLGILQYLKAKFYSRCAWTIVQAEILRNFFFLNGL IGELQD NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgaccaacaggtgccccctccagctcaccgtcctgctgtgtctcgccggggccgcgctc tccgtgaactacagcgagctccgcctccggcagaaaagcagcaattcagcctgtcagcag ctcctgtggcagttgattaaaagccctcagcattgcctggacgacaggatggacttccag atccccaaacaggttgaacaaccacaggagttccggaaggaggaagccatggtggtcatg tacgagatgctccagcagatccacagcatttccagaagaaatttctccaacgctggctgg aatgagaccattgttgagaaccttcaggaggagcttgatgagcagatggacggcctggag aaagccctggaggaaatcaagcaggagggaaagttcccctgggaaagcaggacggtgctg cgcctgaagacctattacttaggcatcctccagtacctgaaggccaagttctacagcaga tgtgcctggacaatagtccaagcggaaatcctcaggaactttttcttccttaacggactt ataggtgagctccaggactga

DBGET integrated database retrieval system