Myotis daubentonii (Daubenton's bat): 132225178 Help Entry 132225178         CDS       T10294                                  Name (RefSeq) ras-related protein Rap-1b-like   KO K07836   Ras-related protein Rap-1B Organism mdt  Myotis daubentonii (Daubenton's bat) Pathway mdt04010   MAPK signaling pathway mdt04014   Ras signaling pathway mdt04015   Rap1 signaling pathway mdt04024   cAMP signaling pathway mdt04062   Chemokine signaling pathway mdt04510   Focal adhesion mdt04520   Adherens junction mdt04611   Platelet activation mdt04670   Leukocyte transendothelial migration mdt04720   Long-term potentiation mdt04722   Neurotrophin signaling pathway mdt04934   Cushing syndrome mdt04972   Pancreatic secretion mdt05211   Renal cell carcinoma mdt05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mdt00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     132225178    04014 Ras signaling pathway     132225178    04015 Rap1 signaling pathway     132225178    04024 cAMP signaling pathway     132225178  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     132225178    04520 Adherens junction     132225178  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     132225178    04670 Leukocyte transendothelial migration     132225178    04062 Chemokine signaling pathway     132225178   09154 Digestive system    04972 Pancreatic secretion     132225178   09156 Nervous system    04720 Long-term potentiation     132225178    04722 Neurotrophin signaling pathway     132225178  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     132225178   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     132225178   09167 Endocrine and metabolic disease    04934 Cushing syndrome     132225178  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mdt04147]     132225178    04031 GTP-binding proteins [BR:mdt04031]     132225178 Exosome [BR:mdt04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    132225178   Exosomal proteins of other body fluids (saliva and urine)    132225178   Exosomal proteins of colorectal cancer cells    132225178 GTP-binding proteins [BR:mdt04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     132225178 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU G-alpha MMR_HSR1 Motif Other DBs NCBI-GeneID:  132225178 NCBI-ProteinID:  XP_059536448 LinkDB All DBs Position X:85295195..85297129 Genome browser AA seq 184 aa AA seqDB search MREYKLVVLGSGGIGKSAPTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPGPGKARKKSS CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgagtataagctagtcgttcttggctcaggaggcattggaaaatccgctccgact gtacagtttgttcaaggaatttttgttgaaaaatatgatcctactatagaagactcttat agaaagcaagttgaagtagatgcacagcagtgtatgcttgaaatcttggatactgcagga acggaacaatttacagcaatgagggatttgtacatgaaaaatggacaaggctttgcatta gtttattccatcacagcacagtccacatttaatgatttacaagatctgagagaacagatt cttcgagttaaagacactgatgatgttccaatgattctggttggtaataagtgtgacttg gaagatgaaagagttgtaggaaaggaacaaggtcaaaatctagcaagacagtggaacaac tgtgcattcttagaatcctctgcaaaatcaaaaataaatgttaatgagatcttttatgac ctagtgcggcaaattaacagaaaaactccagggcctgggaaggcccgcaaaaagtcatca tgtcaactgctttaa

DBGET integrated database retrieval system