Mercurialis annua (annual mercury): 126667732 Help Entry 126667732         CDS       T10153                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism mean  Mercurialis annua (annual mercury) Pathway mean03420   Nucleotide excision repair mean04120   Ubiquitin mediated proteolysis mean04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:mean00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     126667732    04120 Ubiquitin mediated proteolysis     126667732   09124 Replication and repair    03420 Nucleotide excision repair     126667732  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:mean04121]     126667732    03400 DNA repair and recombination proteins [BR:mean03400]     126667732 Enzymes [BR:mean01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      126667732 Ubiquitin system [BR:mean04121]  Ubiquitin ligases (E3)   UBL E3 ligases    126667732   Multi subunit type E3    SCF complex     Ring finger protein      126667732    Cul2 complex      126667732    Cul3 complex      126667732    Cul4 complex      126667732    Cul7 complex      126667732    Cul8 complex      126667732    Cul9 complex      126667732 DNA repair and recombination proteins [BR:mean03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       126667732     TCR (transcription coupled repair) factors      Cul4-CSA complex       126667732 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-RING_11 Motif Other DBs NCBI-GeneID:  126667732 NCBI-ProteinID:  XP_050216745 LinkDB All DBs Position LG2:complement(53223233..53225146) Genome browser AA seq 116 aa AA seqDB search MATLDSDVPMIPVGDGSSSASCSSKKSKCFEIKKWNAVSLWAWDIVVDNCAICRNHIMDL CIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggcgactctggattccgatgtaccgatgattccggtcggcgacggttcctcatcggca tcttgttcttcaaaaaagagtaaatgtttcgaaattaaaaaatggaacgccgtctctctt tgggcatgggatattgttgttgataattgtgctatctgccgtaaccatattatggatctc tgcattgagtgccaagctaaccaggctagtgctaccagcgaagaatgcactgttgcttgg ggtgtttgtaaccatgcatttcactttcactgcatcagccgatggcttaagactcgccaa gtgtgtccattggataatagtgaatgggagttccagaagtacggacattag

DBGET integrated database retrieval system