KEGG   Methylosinus sp. C49: MSC49_06100
Entry
MSC49_06100       CDS       T09855                                 
Symbol
fabG
Name
(GenBank) beta-ketoacyl-ACP reductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
mecq  Methylosinus sp. C49
Pathway
mecq00061  Fatty acid biosynthesis
mecq00780  Biotin metabolism
mecq01100  Metabolic pathways
mecq01110  Biosynthesis of secondary metabolites
mecq01212  Fatty acid metabolism
mecq01240  Biosynthesis of cofactors
Module
mecq_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:mecq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    MSC49_06100 (fabG)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    MSC49_06100 (fabG)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    MSC49_06100 (fabG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mecq01004]
    MSC49_06100 (fabG)
Enzymes [BR:mecq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     MSC49_06100 (fabG)
Lipid biosynthesis proteins [BR:mecq01004]
 Fatty acid synthase
  Component type
   MSC49_06100 (fabG)
SSDB
Motif
Pfam: adh_short_C2 adh_short KR NAD_binding_10 Epimerase NmrA THF_DHG_CYH_C RmlD_sub_bind GDP_Man_Dehyd
Other DBs
NCBI-ProteinID: BBU60675
LinkDB
Position
669660..670397
AA seq 245 aa
MFDLSGKTALVTGASGGIGRDIARALHKSGAVVALSGTREEALATLASELGERVHILPCD
LSDKAQAEALVPAAEKAMGGLDILVNNAGITRDMLFMRLKDEDWDAVLNVNLTSAFRLSR
AALRGMMRKRFGRIIGITSVVGVTGNAGQGNYAAAKAGMIGMTKSLAAEVASRGITVNCV
APGFIESPMTDALNETQKQTILRAVPAGRLGTGADVAAAVVYLSSDESAYVTGQTLHVNG
GMAMI
NT seq 738 nt   +upstreamnt  +downstreamnt
atgttcgatctgagcggcaagacggcgctggtcactggcgcgagcggcggcatcggccgg
gacatcgcgcgcgctctgcataagagcggcgctgtggtggcgctttcgggcacgcgcgag
gaagcgctcgcgacgctcgcctcggaactcggcgagcgcgtccatattctcccttgcgat
ctctccgacaaggcgcaggccgaggcgctggtcccggcggcggaaaaggccatgggcggg
ctcgacattctggtcaacaacgcaggcattacccgcgacatgctgttcatgcgcctcaag
gacgaggattgggacgcggtgctgaacgtcaatctcacctcggccttccgactgtcgcgg
gcggcgctgcgcggcatgatgcgtaagcgcttcggccgcatcatcggcatcacctcggtc
gtcggcgtcaccggcaacgccggccagggcaattacgccgccgccaaggccggcatgatc
ggcatgaccaaatcgctggcggccgaggtcgcctcgcgcggcatcaccgtcaattgcgtg
gcgcccggctttatcgagagcccgatgaccgacgcgctgaacgagacgcagaaacagacg
attctgcgcgccgtgccggccggacggctgggcacgggcgccgatgtcgccgccgccgtc
gtctatctttcgagcgacgaatcggcctatgtcaccggccagactctgcatgtgaacggc
ggcatggcgatgatctga

DBGET integrated database retrieval system