Methanimicrococcus stummii: MmiEs2_10540 Help Entry MmiEs2_10540      CDS       T09451                                  Name (GenBank) hypothetical protein   KO K00188   2-oxoisovalerate ferredoxin oxidoreductase delta subunit [EC:1.2.7.7] Organism mees  Methanimicrococcus stummii Pathway mees00280   Valine, leucine and isoleucine degradation mees01100   Metabolic pathways mees01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:mees00001]  09100 Metabolism   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     MmiEs2_10540 Enzymes [BR:mees01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.7  3-methyl-2-oxobutanoate dehydrogenase (ferredoxin)      MmiEs2_10540 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_7 Fer4_21 Fer4_9 Fer4_10 Fer4 Fer4_2 Fer4_16 Fer4_8 Fer4_17 Fer4_22 Fer4_4 Fer4_6 Fer4_13 Fer4_3 OrsD Motif Other DBs NCBI-ProteinID:  WNY28846 UniProt:  A0AA96VID0 LinkDB All DBs Position complement(1086829..1087080) Genome browser AA seq 83 aa AA seqDB search MSEAQEKQSPYPVIHALECKACGRCILDCPRKVLEMGTVLNERGYTYVVYKGEGCSGCGN CYYMCPEPNAIEVHVPKKTKTEA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgtctgaagcacaagaaaaacagtctccttatccggttattcacgcgctggaatgcaag gcctgcggccgctgcattttggattgcccgagaaaggttttggagatgggaacggttttg aacgaacgcggctacacttatgtggtttacaaaggcgaaggctgcagcggctgcggcaac tgctattacatgtgccccgagccgaacgcgattgaagttcacgttccgaagaaaacgaaa acggaggcttaa

DBGET integrated database retrieval system