Methanimicrococcus hongohii: MmiHf6_00120 Help Entry MmiHf6_00120      CDS       T09450                                  Name (GenBank) hypothetical protein   KO K00188   2-oxoisovalerate ferredoxin oxidoreductase delta subunit [EC:1.2.7.7] Organism mehf  Methanimicrococcus hongohii Pathway mehf00280   Valine, leucine and isoleucine degradation mehf01100   Metabolic pathways mehf01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:mehf00001]  09100 Metabolism   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     MmiHf6_00120 Enzymes [BR:mehf01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.7  3-methyl-2-oxobutanoate dehydrogenase (ferredoxin)      MmiHf6_00120 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_7 Fer4_9 Fer4_10 Fer4_21 Fer4 Fer4_16 Fer4_2 Fer4_8 Fer4_22 Fer4_4 Fer4_6 Fer4_13 Fer4_3 OrsD Motif Other DBs NCBI-ProteinID:  WNY22727 UniProt:  A0AA96V921 LinkDB All DBs Position 16388..16639 Genome browser AA seq 83 aa AA seqDB search MSELQEKQSPYPVIHTLECKACGRCILDCPRKVLEMGTVLNERGYTYVVYKGEGCSGCGN CYYMCPEPNAIEVHVPKKTKTEA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgtctgaattacaagaaaaacagtctccttatccggttatccatacgcttgaatgcaag gcttgcggtcgctgcattttggattgcccgagaaaagtcttggagatgggaacggttttg aacgaacgcggttacacgtacgtggtctacaagggagaaggctgcagcggctgcggcaac tgttattatatgtgccccgagccgaatgcgattgaagttcacgtaccgaaaaaaacaaaa acggaggcctga

DBGET integrated database retrieval system