Methanobacterium alkalithermotolerans: HYG87_02760 Help Entry HYG87_02760       CDS       T07794                                  Name (GenBank) ferredoxin family protein   KO K00188   2-oxoisovalerate ferredoxin oxidoreductase delta subunit [EC:1.2.7.7] Organism meme  Methanobacterium alkalithermotolerans Pathway meme00280   Valine, leucine and isoleucine degradation meme01100   Metabolic pathways meme01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:meme00001]  09100 Metabolism   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     HYG87_02760 Enzymes [BR:meme01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.7  3-methyl-2-oxobutanoate dehydrogenase (ferredoxin)      HYG87_02760 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_7 Fer4_10 Fer4_21 Fer4_9 Fer4 Fer4_6 Fer4_4 Fer4_2 Fer4_16 Fer4_8 LdpA_Fe-S-bd Fer4_17 Fer4_22 Fer4_3 Fer4_13 Motif Other DBs NCBI-ProteinID:  QUH22770 UniProt:  A0A8T8K6Z5 LinkDB All DBs Position 593784..594038 Genome browser AA seq 84 aa AA seqDB search MKASKKSGACPVINIDECKACDRCILACPRDVLEMSMDLNKRGYHYVVYKGEGCNGCGNC YYTCPEPLAIEVHIPRKVKPQEDE NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgaaagcttctaaaaaatcaggtgcttgccctgttatcaatattgatgagtgtaaagcc tgcgatagatgtattttagcctgccctcgtgatgtacttgaaatgagtatggatttgaat aagaggggttaccactatgtggtctataagggggaaggatgtaatggatgtggaaactgt tactatacctgtcctgaacccctggccattgaagtgcatattccccgaaaagttaaacct caggaggatgaataa

DBGET integrated database retrieval system