Methylovorus sp. MP688: MPQ_0922 Help Entry MPQ_0922          CDS       T01361                                  Symbol folA Name (GenBank) Dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism mep  Methylovorus sp. MP688 Pathway mep00670   One carbon pool by folate mep00790   Folate biosynthesis mep01100   Metabolic pathways mep01240   Biosynthesis of cofactors mep04981   Folate transport and metabolism Module mep_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:mep00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     MPQ_0922 (folA)    00670 One carbon pool by folate     MPQ_0922 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     MPQ_0922 (folA) Enzymes [BR:mep01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      MPQ_0922 (folA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  ADQ84091 LinkDB All DBs Position 918939..919427 Genome browser AA seq 162 aa AA seqDB search MPKLSLIVAIAHDGVIGVNNTLPWHLPEDLKRFRALTMGHHIIMGRKTYESLNRLLPGRT TVIVTRNADYRVEGALVSSSLEDALAQSAGDDEVFLIGGAELYREGLAKADQLYITEIDA HFEGDAFFPQMDRGQWQLIEEERHVSEQGLPFRYLTYRRNAA NT seq 489 nt NT seq  +upstreamnt  +downstreamnt atgcccaaactctctcttatcgtagccatcgcgcatgatggcgtcatcggggtcaataat accctgccttggcatttgcccgaagacctcaagcgctttcgcgccttgaccatgggccat catatcatcatgggccgaaaaacctatgagtcactgaaccgcctgttgccgggccgcacc accgtcattgtcacgcgcaatgcggactatcgggttgaaggcgcactggtgtccagctcg ctggaagatgcccttgcacagtcggcaggcgatgatgaggtgttcctcatcggtggtgca gaactttaccgtgaaggtcttgccaaagcggatcagctctacattacggaaattgatgcc cactttgaaggcgatgctttttttccgcagatggatagggggcaatggcagctcatcgaa gaggagcgccatgtcagtgaacaaggcttgccattccgctatctgacttacagacgcaac gcagcctaa

DBGET integrated database retrieval system