KEGG   Macrococcus equipercicus: KFV11_06170
Entry
KFV11_06170       CDS       T08514                                 
Name
(GenBank) polyprenyl synthetase family protein
  KO
K21275  hexaprenyl-diphosphate synthase large subunit [EC:2.5.1.83]
Organism
mequ  Macrococcus equipercicus
Pathway
mequ00900  Terpenoid backbone biosynthesis
mequ01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mequ00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    KFV11_06170
Enzymes [BR:mequ01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.83  hexaprenyl diphosphate synthase [(2E,6E)-farnesyl-diphosphate specific]
     KFV11_06170
SSDB
Motif
Pfam: polyprenyl_synt
Other DBs
NCBI-ProteinID: UTH12871
LinkDB
Position
complement(1199078..1200022)
AA seq 314 aa
MITMNESIRSVESLLNEVISDNHSSLNEAGKHILTSGGKRIRPYFVLLAGTFGSADDDTL
IRTATALEIIHMASLVHDDYIDNSAKRRGVSAVHEEWNAPVAIQTGHYLLASALNLISGI
DNQSYHQYFADVILEVCYGEFAQMEDQFNTAVSFTKYLRRINRKTAILLEASCKLGGLST
GAADKEIYHLGKFGHFMGMSFQIIDDVLDYTSNEAALGKPVGSDIRNGHMTLPLMCAVKH
DAQLSALLAELHAGQSEDYFRQVIEAVRAAGITPALDISAAYARKAAAHLHELPETPARA
KMQELLDRMTRRTY
NT seq 945 nt   +upstreamnt  +downstreamnt
atgatcactatgaatgaaagtatccgctcagttgaatcgttgttaaatgaggtcatcagt
gacaatcattcttccttgaacgaagcggggaagcacattttgacgtctggtggtaagaga
atcagaccttatttcgtgctgctggccgggacattcggcagtgcggacgatgacactttg
atccggaccgcaactgcactggaaattatccatatggcgagtcttgtccatgatgactat
atcgacaacagcgctaaaagacggggggtcagcgctgttcatgaagaatggaatgcaccg
gtagccatacagaccggacattatctcctcgcctcggcgcttaacttgatctctggcatt
gataatcagtcctatcatcagtacttcgcagacgttattctggaagtgtgctacggagag
ttcgcacagatggaagatcagtttaatacggctgtatcatttacgaagtatttgaggcgc
atcaacagaaagaccgcgatcctgcttgaggcgagctgcaaacttggtggtctcagcacg
ggggcagctgacaaagagatttatcatctcggtaagttcggtcattttatggggatgagc
tttcagatcatcgatgatgtactggattatacaagcaatgaagcagcccttggtaaaccg
gtcggcagtgatatcaggaatggtcatatgacactcccgctgatgtgcgccgtaaaacat
gacgcgcagctgagcgcactgcttgctgaacttcacgccgggcagtctgaagattatttc
agacaggtcattgaagcggtgagagcagcaggtattactcctgctttggacatcagtgca
gcctatgcccgaaaagcggccgctcatctccatgaactgcctgagacaccggctcgagca
aagatgcaggaactgctggaccggatgacaagacggacatattag

DBGET integrated database retrieval system