Chelativorans sp. BNC1: Meso_1413 Help Entry Meso_1413         CDS       T00374                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism mes  Chelativorans sp. BNC1 Pathway mes00790   Folate biosynthesis mes01100   Metabolic pathways mes01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:mes00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     Meso_1413 Enzymes [BR:mes01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      Meso_1413  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      Meso_1413  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      Meso_1413 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  ABG62809 UniProt:  Q11IG6 LinkDB All DBs Position 1512432..1512791 Genome browser AA seq 119 aa AA seqDB search MYSIRLRNCAFYARHGLLDEEAALGQRFYVDAELLVEPEVPLEEASIGTTVDYGVAFSLI EKIVTGERCPLIETLALRIAKSLCARFPQIKHATITVRKPSAPIAGVLDYVEVTVDWPQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt gtgtactccatccgattgaggaattgcgcgttctacgctcggcatggcttgctcgacgag gaggcggcgctgggccagcgattctatgtcgacgccgagctccttgtggagcctgaagtg ccgctggaggaggcttccatcgggacgactgtcgattatggcgtcgccttctcccttatt gagaaaatcgtcacgggcgagcgttgcccgcttatcgaaacgctggcacttcggatcgca aagtcgctatgcgcaagattccctcaaatcaagcatgcaacgatcacggttcgaaagccg tccgcgcccattgccggcgtcttggattatgtcgaggtaacggttgactggccccaatag

DBGET integrated database retrieval system