Manihot esculenta (cassava): 110610839 Help Entry 110610839         CDS       T05761                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism mesc  Manihot esculenta (cassava) Pathway mesc00510   N-Glycan biosynthesis mesc00513   Various types of N-glycan biosynthesis mesc04141   Protein processing in endoplasmic reticulum Module mesc_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:mesc00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     110610839    00513 Various types of N-glycan biosynthesis     110610839  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     110610839 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 LapA_dom Motif Other DBs NCBI-GeneID:  110610839 NCBI-ProteinID:  XP_021606605 LinkDB All DBs Position 3:complement(2829459..2832020) Genome browser AA seq 76 aa AA seqDB search MATKSITSPVPDAWYPTLAVSMLAIGLLVTASFFVYEATSSRRNRSLAKELTTGAMASFF LGFGSLFLLLASGVYV NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggctacaaaatcgatcacgagtcctgtccccgatgcatggtatccaaccctagccgtc tcgatgcttgcgatcggcctcttggtcactgcttccttcttcgtgtatgaagcaacttca tctaggcggaatcggagtcttgccaaggagcttacaacaggagctatggcatctttcttt ctgggtttcgggtccttgttcctgctactagcttctggtgtttatgtttag

DBGET integrated database retrieval system