Mesorhizobium sp. J8: MJ8_35880 Help Entry MJ8_35880         CDS       T10402                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism mesj  Mesorhizobium sp. J8 Pathway mesj00790   Folate biosynthesis mesj01100   Metabolic pathways mesj01240   Biosynthesis of cofactors Module mesj_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:mesj00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     MJ8_35880 Enzymes [BR:mesj01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      MJ8_35880  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      MJ8_35880  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      MJ8_35880 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB AMPK1_CBM Motif Other DBs NCBI-ProteinID:  BCM19807 UniProt:  A0A7R7E7L1 LinkDB All DBs Position complement(3746094..3746453) Genome browser AA seq 119 aa AA seqDB search MYVIRMKNCAFFARHGVLDEEETLGQRFYVDAELTVEPSRPLTEDSIEDTVNYGVAFAVI EEIVTGHRRFLIEALALEVAKALTARFSQIKKAAITVRKPNAPVPGVLDHVEVSVVWPE NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgtacgtcatccgcatgaagaactgcgccttcttcgcccgccacggcgtgctggacgag gaggagacgcttggccagcgtttctacgtcgatgccgagctgacggtcgagcccagccgg ccgctgacggaggattccatcgaggacaccgtcaattacggcgtcgccttcgcggtcatc gaggaaatcgtgaccggacatcgccgcttcctgatcgaggcgctggcgctggaggtagcg aaggccctgacggcacgattctcgcaaatcaagaaggccgcgatcaccgtgcgcaaaccg aacgctccggtgccgggcgtgctcgatcatgtcgaggtgagtgttgtctggccagaatag

DBGET integrated database retrieval system