KEGG   Mesorhizobium sp. Pch-S: C1M53_22525
Entry
C1M53_22525       CDS       T05918                                 
Name
(GenBank) DNA ligase (NAD(+)) LigA
  KO
K01972  DNA ligase (NAD+) [EC:6.5.1.2]
Organism
mesp  Mesorhizobium sp. Pch-S
Pathway
mesp03030  DNA replication
mesp03410  Base excision repair
mesp03420  Nucleotide excision repair
mesp03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mesp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    C1M53_22525
   03410 Base excision repair
    C1M53_22525
   03420 Nucleotide excision repair
    C1M53_22525
   03430 Mismatch repair
    C1M53_22525
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mesp03032]
    C1M53_22525
   03400 DNA repair and recombination proteins [BR:mesp03400]
    C1M53_22525
Enzymes [BR:mesp01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.2  DNA ligase (NAD+)
     C1M53_22525
DNA replication proteins [BR:mesp03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     C1M53_22525
DNA repair and recombination proteins [BR:mesp03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA ligase
     C1M53_22525
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     C1M53_22525
   MMR (mismatch excision repair)
    DNA ligase
     C1M53_22525
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      C1M53_22525
SSDB
Motif
Pfam: DNA_ligase_aden DNA_ligase_OB BRCT HHH_2 DNA_ligase_ZBD PTCB-BRCT Nlig-Ia Zn_ribbon_PaaD Filo_glycop
Other DBs
NCBI-ProteinID: QAZ45294
LinkDB
Position
4803342..4805555
AA seq 737 aa
MSEQNKPIEALSAEEAAAELERLAAEIREHDRRYHGEDAPIITDAEYDALRRRNAAIEEA
FPDLVRSDSPTGSVGSAPAEGFAKVRHAVPMLSLAKAYTDQDVVDFLERAKRFFERDKDF
DIAFTAEPKIDGLSASLRYENGVFVQGATRGDGAVGEDITANLKTIADIPHRLKGSGWPE
VIEIRGEVYMTYAEFQALKERSAAAGGQDYVNPRNTAAGSLRQKDPSVTASRNLKFFAYA
WGYTSEDPAPTQYEAVQKFAGWGFKVSPLMVRARSVDDLIAQYRLIEEQRSSLGYDIDGV
VYKVDQLELQRRWGFVTGEPRWAVAHKFPAEQATTIVRKIDIQVGRTGTLAPVARLDPVT
VGGVTVVNVTLHNEDYIKGFDSNGEPIREGNDIRIGDTVVIQRAGDVIPQIVSVVVDKRP
AAAVPYEFPHACPVCGSAATREINEKTGKEDSRRRCTGELICPAQAVERLRHFVSRGAMD
IEGLGAENIDLFFNAGLLETAADIFRLKDRRAEVQQALFERREAQAQAREAAKGATRKKV
LTAEERTYEGLEKLFDAIDARREPELDRFIFALGIRHIGETTAAALSKTFSTAEEFIRVG
KEASQADDPKTVFPSINGIGDTVIGALCDFFGNERNDDVLDALLQQVHPKPYIVSVSADS
QVAGKTVVFTGSLEKMSRSEAKAMAERLGAKVAGSVSAKTDLVVAGPGAGSKLKLASELG
IEVIDEDTWFERVGRSV
NT seq 2214 nt   +upstreamnt  +downstreamnt
atgtctgaacagaacaagcccatcgaagctttgagtgccgaagaagcggcggcggaactc
gagcgcttggccgccgagatcagagagcatgaccgccgttatcatggcgaagatgcgcca
atcatcacggacgcggagtatgacgccttgcggcgacgcaacgctgcgatcgaggaggcg
ttcccggatctggtacggtccgacagcccgaccggctctgtcggatcggcaccggccgaa
ggcttcgccaaggttcgccatgccgtaccgatgcttagtctcgccaaggcctataccgat
caggatgtggtggatttcctggaacgggcgaagcgtttcttcgagcgcgacaaggatttc
gacatcgcgttcacggcagagcccaagattgatgggctctccgcgtcgcttcgttacgaa
aatggtgttttcgtccagggtgccacgcgtggtgacggcgcggttggtgaggacattacc
gccaatctgaagaccatcgccgacatcccacacaggctgaaaggctcgggctggccagaa
gtgatcgaaatccgtggcgaggtctatatgacctacgccgaattccaggctttgaaggaa
cgctccgctgccgcgggtggccaggactacgtcaatccgcgcaacacggcggccggctca
ttgcggcagaaggatccgtccgttaccgccagccgcaacctcaaattctttgcctatgcc
tggggctacacttccgaagaccctgcgccgacgcaatatgaggcggtgcagaaattcgcc
ggctggggatttaaagtcagtccgctgatggtccgcgccagatcggtggacgatctgatc
gctcagtacaggcttatcgaggagcagcggtcttcgctcggttacgatatcgacggcgtc
gtctacaaggtcgaccagctcgagttgcagcgccgctggggtttcgtcacaggcgagccg
cgctgggcggttgcgcataaattccctgccgagcaggcgacgacgatcgtgcgcaagatc
gacatccaggtcggccgcaccggaacgctggcgccggttgcccggctggatccagtgacc
gtgggcggtgtcaccgtcgtcaatgtgacgctgcacaacgaagactacatcaagggcttc
gacagcaacggcgaaccgatccgcgagggcaacgatattcgtatcggcgacacggtggtg
atccagcgggcaggggatgtcatcccgcagatcgtcagcgtggtggtcgacaaacgcccc
gctgcggccgtgccttatgagttcccgcatgcgtgcccggtctgtggctcggcagcgacg
cgggagatcaacgagaagaccggtaaggaggattcgcgccggcgttgcacgggtgaactg
atctgtccggcgcaggcggttgagagactgcgccattttgtttcgcgcggtgcaatggat
atcgaaggactgggtgccgaaaacatcgatctgtttttcaacgccggcctcctggaaacc
gctgcggacattttcagactgaaagaccggcgcgcggaggtacagcaggctctcttcgag
aggcgcgaggcacaggcgcaggcgcgcgaggccgccaagggcgcgacccgcaagaaggtg
ctcaccgccgaggagcgcacctatgaagggctcgaaaagcttttcgacgccatcgatgcg
cgccgtgaaccggaactcgatcgtttcatctttgcacttggcatccgccacatcggcgaa
acgacggccgctgcactttcgaagacattctcgacggcggaagagttcatccgcgtgggc
aaggaagcgtctcaggcggatgatccgaagaccgtcttcccgtccatcaacgggattggc
gatacggtcatcggtgcgctgtgcgacttcttcggcaatgagcgtaacgatgatgtgctg
gacgcattgctgcagcaggttcaccccaaaccctatatcgtcagcgtgtcggccgacagc
caggtcgccgggaagaccgtggtgttcaccggatccctggagaagatgtcacgttcggaa
gccaaggcgatggccgaacggctgggtgctaaggtcgccggatcggtctcggccaaaacc
gacctcgtggttgccggacctggcgcgggctcgaaactcaagctggcgagcgagctgggc
atcgaggtcatcgacgaggacacctggttcgagagggttgggcgaagcgtgtga

DBGET integrated database retrieval system