Methanobacterium sp. BAmetb5: CIT02_06150 Help Entry CIT02_06150       CDS       T05745                                  Name (GenBank) 4Fe-4S ferredoxin   KO K00188   2-oxoisovalerate ferredoxin oxidoreductase delta subunit [EC:1.2.7.7] Organism meto  Methanobacterium sp. BAmetb5 Pathway meto00280   Valine, leucine and isoleucine degradation meto01100   Metabolic pathways meto01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:meto00001]  09100 Metabolism   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     CIT02_06150 Enzymes [BR:meto01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.7  3-methyl-2-oxobutanoate dehydrogenase (ferredoxin)      CIT02_06150 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_7 Fer4_9 Fer4_10 Fer4_21 Fer4_6 Fer4_2 Fer4 Fer4_22 Fer4_16 Fer4_4 Fer4_13 Fer4_17 Fer4_8 Fer4_3 Motif Other DBs NCBI-ProteinID:  AXV39921 UniProt:  A0A347ALS4 LinkDB All DBs Position complement(1283717..1283986) Genome browser AA seq 89 aa AA seqDB search MRSHKKEPYPVFNELECKACERCILACRAGVLKMSEDINERGYHYAEYTGKGCTGCGDCY YTCPEPLAVEVHIPRRKRIKKQSKGDEEE NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgagaagccataaaaaagaaccatatccagtattcaatgaactggaatgtaaagcatgt gaacgttgcattctcgcctgccgcgctggtgtcctcaagatgagtgaagacattaacgag cgtggttaccattatgccgagtatactggaaagggatgcactggttgtggggactgttat tacacctgccctgaaccactggccgtggaagttcacatacctcggagaaagagaatcaaa aaacagagcaaaggggatgaggaggaatag

DBGET integrated database retrieval system