Methanobacterium formicicum DSM1535: DSM1535_1555 Help Entry DSM1535_1555      CDS       T03743                                  Name (GenBank) hypothetical protein   KO K00188   2-oxoisovalerate ferredoxin oxidoreductase delta subunit [EC:1.2.7.7] Organism mfi  Methanobacterium formicicum DSM1535 Pathway mfi00280   Valine, leucine and isoleucine degradation mfi01100   Metabolic pathways mfi01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:mfi00001]  09100 Metabolism   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     DSM1535_1555 Enzymes [BR:mfi01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.7  3-methyl-2-oxobutanoate dehydrogenase (ferredoxin)      DSM1535_1555 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_7 Fer4_10 Fer4_9 Fer4_21 Fer4_6 Fer4_2 Fer4 Fer4_22 Fer4_16 Fer4_4 Fer4_13 Fer4_17 Fer4_8 Fer4_3 Motif Other DBs NCBI-ProteinID:  CEA13887 UniProt:  A0A090I991 LinkDB All DBs Position 1:1552583..1552852 Genome browser AA seq 89 aa AA seqDB search MKSHKKEPYPVFNELECKACERCILACRAGVLKMSEDINERGYHYAEYTGKGCTGCGDCY YTCPEPLAVEVHIPRRKRIKKQIKGDEEE NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgaagagccataaaaaagaaccatatccagtattcaatgaactggaatgtaaagcatgt gaacgttgcatcctcgcctgccgcgccggtgtcctcaagatgagtgaagacattaacgag cgtggttaccattatgccgagtacactggaaagggatgcactggctgtggggactgttat tacacctgtcctgaaccactggccgtggaagttcacatacctcggagaaagagaatcaaa aaacagatcaaaggggatgaggaggaatag

DBGET integrated database retrieval system