Alexandromys fortis (reed vole): 126491626 Help Entry 126491626         CDS       T08493                                  Name (RefSeq) CD209 antigen-like protein E   KO K06563   C-type lectin domain family 4 member L/M Organism mfot  Alexandromys fortis (reed vole) Pathway mfot03260   Virion - Human immunodeficiency virus mfot03264   Virion - Flavivirus and Alphavirus mfot03265   Virion - Ebolavirus, Lyssavirus and Morbillivirus mfot03273   Virion - Lassa virus and SFTS virus mfot04145   Phagosome mfot04625   C-type lectin receptor signaling pathway mfot05152   Tuberculosis mfot05162   Measles Brite KEGG Orthology (KO) [BR:mfot00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03260 Virion - Human immunodeficiency virus     126491626    03264 Virion - Flavivirus and Alphavirus     126491626    03265 Virion - Ebolavirus, Lyssavirus and Morbillivirus     126491626    03273 Virion - Lassa virus and SFTS virus     126491626  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     126491626  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     126491626  09160 Human Diseases   09172 Infectious disease: viral    05162 Measles     126491626   09171 Infectious disease: bacterial    05152 Tuberculosis     126491626  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mfot04131]     126491626   09183 Protein families: signaling and cellular processes    04054 Pattern recognition receptors [BR:mfot04054]     126491626    04515 Cell adhesion molecules [BR:mfot04515]     126491626    04090 CD molecules [BR:mfot04090]     126491626    04091 Lectins [BR:mfot04091]     126491626 Membrane trafficking [BR:mfot04131]  Endocytosis   Phagocytosis    C-lectin receptors     126491626 Pattern recognition receptors [BR:mfot04054]  Membrane-bound pattern recognition receptors   C-type lectin receptors    126491626 Cell adhesion molecules [BR:mfot04515]  Lectins   Selectins and C-type lectins    126491626 CD molecules [BR:mfot04090]  Proteins   126491626 Lectins [BR:mfot04091]  C-Type lectins   Asialoglycoprotein and DC receptors    126491626 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Lectin_C Chordopox_A33R Motif Other DBs NCBI-GeneID:  126491626 NCBI-ProteinID:  XP_049983384 LinkDB All DBs Position Unknown AA seq 215 aa AA seqDB search MTVGDSKEAGVQQMGCLGFLDRGHISLVLQLLSLVFFAGLLAAIVIQVSKIPSSEEIQWE QKKQEKMFQDLSQLKSEVDSLCRRCPWDWTFFKGNCYFFSKSQRDWHDSITACQELGAQL VIIKSHEEQYFLQQASKKNGYTWMGLSDLNKEGAWYWLDGSPLSDRFARYWKKGQPNNFE GQDCVEFRDDGWNDAKCDDMKLWICKKSSTTCPSK NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgactgtgggtgactccaaagaagcaggggtgcagcagatgggctgtctgggatttctg gaccgaggccacatctccctggtgctgcagctgctgtcactcgttttctttgccggactc ctggctgccatcgtcatccaagtttccaagatccccagctcagaggaaatacagtgggaa cagaaaaagcaggagaaaatgttccaggacctgagccagctgaagtctgaagttgatagc ctctgtcgccgctgtccttgggattggacattcttcaagggaaactgttacttcttctcc aagtcacaacgcgactggcatgactccatcactgcctgccaggaactgggagcccagctg gtcatcatcaaaagtcatgaggagcagtacttcctgcagcaagcttccaagaaaaatggc tacacctggatggggttgtcagacctgaacaaggaaggtgcatggtattggctggatggt tcacctctgtcagacagatttgcgaggtactggaaaaaaggacagcccaacaactttgag ggacaagactgtgtggaattcagagatgacggctggaatgatgccaaatgtgatgacatg aaattatggatctgcaaaaaatcctcaactacctgtcccagcaagtga

DBGET integrated database retrieval system