Alexandromys fortis (reed vole): 126491627 Help Entry 126491627         CDS       T08493                                  Name (RefSeq) CD209 antigen-like protein D   KO K06563   C-type lectin domain family 4 member L/M Organism mfot  Alexandromys fortis (reed vole) Pathway mfot03260   Virion - Human immunodeficiency virus mfot03264   Virion - Flavivirus and Alphavirus mfot03265   Virion - Ebolavirus, Lyssavirus and Morbillivirus mfot03273   Virion - Lassa virus and SFTS virus mfot04145   Phagosome mfot04625   C-type lectin receptor signaling pathway mfot05152   Tuberculosis mfot05162   Measles Brite KEGG Orthology (KO) [BR:mfot00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03260 Virion - Human immunodeficiency virus     126491627    03264 Virion - Flavivirus and Alphavirus     126491627    03265 Virion - Ebolavirus, Lyssavirus and Morbillivirus     126491627    03273 Virion - Lassa virus and SFTS virus     126491627  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     126491627  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     126491627  09160 Human Diseases   09172 Infectious disease: viral    05162 Measles     126491627   09171 Infectious disease: bacterial    05152 Tuberculosis     126491627  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mfot04131]     126491627   09183 Protein families: signaling and cellular processes    04054 Pattern recognition receptors [BR:mfot04054]     126491627    04515 Cell adhesion molecules [BR:mfot04515]     126491627    04090 CD molecules [BR:mfot04090]     126491627    04091 Lectins [BR:mfot04091]     126491627 Membrane trafficking [BR:mfot04131]  Endocytosis   Phagocytosis    C-lectin receptors     126491627 Pattern recognition receptors [BR:mfot04054]  Membrane-bound pattern recognition receptors   C-type lectin receptors    126491627 Cell adhesion molecules [BR:mfot04515]  Lectins   Selectins and C-type lectins    126491627 CD molecules [BR:mfot04090]  Proteins   126491627 Lectins [BR:mfot04091]  C-Type lectins   Asialoglycoprotein and DC receptors    126491627 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DUF2106 ComA Motif Other DBs NCBI-GeneID:  126491627 NCBI-ProteinID:  XP_049983386 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MTTKLCNQKLGSYNNEYRKHSCNPSVLQLLSNFLFLAWLLLIILALVSKVPSSQSQDKIY QELMQLKTEVDDDLCQPYQRDCVFFRGNCYVFSKSQSNWYNSINACQEVGAQMVIIETEG EQVHWWGTPLVWNTHLAVVT NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atgacgaccaaactttgcaatcaaaagcttggcagctataataatgagtatcggaagcac agctgcaacccctcggtcctgcagttgctctcgaacttcctgtttttagcttggcttctg ctgatcattcttgccctagtctcaaaggtccccagctcccagagtcaagacaaaatctac caggagctcatgcagctgaagactgaagtagatgatgacttgtgtcaaccctaccaaagg gactgtgtgttctttcgtggaaactgttatgtcttctccaagtcccaaagcaactggtac aactccatcaatgcctgccaggaagtgggggcccaaatggtcatcatagagactgagggg gagcaggtccactggtggggcaccccccttgtctggaacacacatctggctgtggtcacc tga

DBGET integrated database retrieval system