Alexandromys fortis (reed vole): 126499184 Help Entry 126499184         CDS       T08493                                  Name (RefSeq) fibroblast growth factor 2   KO K18497   fibroblast growth factor 2 Organism mfot  Alexandromys fortis (reed vole) Pathway mfot01521   EGFR tyrosine kinase inhibitor resistance mfot04010   MAPK signaling pathway mfot04014   Ras signaling pathway mfot04015   Rap1 signaling pathway mfot04020   Calcium signaling pathway mfot04151   PI3K-Akt signaling pathway mfot04550   Signaling pathways regulating pluripotency of stem cells mfot04810   Regulation of actin cytoskeleton mfot05167   Kaposi sarcoma-associated herpesvirus infection mfot05200   Pathways in cancer mfot05205   Proteoglycans in cancer mfot05207   Chemical carcinogenesis - receptor activation mfot05218   Melanoma mfot05224   Breast cancer mfot05226   Gastric cancer Brite KEGG Orthology (KO) [BR:mfot00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     126499184    04014 Ras signaling pathway     126499184    04015 Rap1 signaling pathway     126499184    04020 Calcium signaling pathway     126499184    04151 PI3K-Akt signaling pathway     126499184  09140 Cellular Processes   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     126499184   09142 Cell motility    04810 Regulation of actin cytoskeleton     126499184  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     126499184    05205 Proteoglycans in cancer     126499184    05207 Chemical carcinogenesis - receptor activation     126499184   09162 Cancer: specific types    05226 Gastric cancer     126499184    05218 Melanoma     126499184    05224 Breast cancer     126499184   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     126499184   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     126499184  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mfot04052]     126499184    00536 Glycosaminoglycan binding proteins [BR:mfot00536]     126499184 Cytokines and neuropeptides [BR:mfot04052]  Cytokines   Growth factors (RTK binding)    126499184 Glycosaminoglycan binding proteins [BR:mfot00536]  Heparan sulfate / Heparin   Growth factors/receptors    126499184 SSDB OrthologParalogGFIT Motif Pfam:  FGF Fascin IL1 WD40_RFWD3 Motif Other DBs NCBI-GeneID:  126499184 NCBI-ProteinID:  XP_049994247 LinkDB All DBs Position Unknown AA seq 154 aa AA seqDB search MAAGGITTLPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVK LQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYS GWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS NT seq 465 nt NT seq  +upstreamnt  +downstreamnt atggctgccggcggcatcaccacgcttcccgcactgcccgaggatggcggcgccgccttc ccgcccggccacttcaaggaccccaagcggctctactgcaagaacggcggcttcttcctg cgcatccaccccgacggccgcgtggacggcgtccgcgagaagagcgacccacacgtcaaa ctacagctccaagcggaagagagaggggttgtgtctatcaagggagtgtgtgcaaaccgg taccttgctatgaaggaagacggacggctgctggcttctaagtgtgttacagaagagtgt ttcttttttgaacgactggaatccaataactacaatacttaccggtcaaggaaatactcc ggatggtatgtggcactgaaacgaactgggcagtataaactcggatccaaaacgggacct gggcagaaggccatactgtttcttccgatgtctgctaagagctga

DBGET integrated database retrieval system