Microtus fortis (reed vole): 126500538 Help Entry 126500538         CDS       T08493                                  Name (RefSeq) actin, cytoplasmic 2   KO K05692   actin beta/gamma 1 Organism mfot  Microtus fortis (reed vole) Pathway mfot03082   ATP-dependent chromatin remodeling mfot04015   Rap1 signaling pathway mfot04145   Phagosome mfot04210   Apoptosis mfot04390   Hippo signaling pathway mfot04510   Focal adhesion mfot04520   Adherens junction mfot04530   Tight junction mfot04611   Platelet activation mfot04613   Neutrophil extracellular trap formation mfot04670   Leukocyte transendothelial migration mfot04714   Thermogenesis mfot04810   Regulation of actin cytoskeleton mfot04814   Motor proteins mfot04820   Cytoskeleton in muscle cells mfot04919   Thyroid hormone signaling pathway mfot04921   Oxytocin signaling pathway mfot04971   Gastric acid secretion mfot05014   Amyotrophic lateral sclerosis mfot05100   Bacterial invasion of epithelial cells mfot05132   Salmonella infection mfot05135   Yersinia infection mfot05164   Influenza A mfot05205   Proteoglycans in cancer mfot05225   Hepatocellular carcinoma mfot05410   Hypertrophic cardiomyopathy mfot05412   Arrhythmogenic right ventricular cardiomyopathy mfot05414   Dilated cardiomyopathy mfot05416   Viral myocarditis mfot05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mfot00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     126500538  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     126500538    04390 Hippo signaling pathway     126500538  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     126500538   09143 Cell growth and death    04210 Apoptosis     126500538   09144 Cellular community - eukaryotes    04510 Focal adhesion     126500538    04520 Adherens junction     126500538    04530 Tight junction     126500538   09142 Cell motility    04814 Motor proteins     126500538    04820 Cytoskeleton in muscle cells     126500538    04810 Regulation of actin cytoskeleton     126500538  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     126500538    04613 Neutrophil extracellular trap formation     126500538    04670 Leukocyte transendothelial migration     126500538   09152 Endocrine system    04921 Oxytocin signaling pathway     126500538    04919 Thyroid hormone signaling pathway     126500538   09154 Digestive system    04971 Gastric acid secretion     126500538   09159 Environmental adaptation    04714 Thermogenesis     126500538  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     126500538   09162 Cancer: specific types    05225 Hepatocellular carcinoma     126500538   09172 Infectious disease: viral    05164 Influenza A     126500538   09171 Infectious disease: bacterial    05132 Salmonella infection     126500538    05135 Yersinia infection     126500538    05100 Bacterial invasion of epithelial cells     126500538   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     126500538   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     126500538    05410 Hypertrophic cardiomyopathy     126500538    05412 Arrhythmogenic right ventricular cardiomyopathy     126500538    05414 Dilated cardiomyopathy     126500538    05416 Viral myocarditis     126500538  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:mfot03021]     126500538    03019 Messenger RNA biogenesis [BR:mfot03019]     126500538    03036 Chromosome and associated proteins [BR:mfot03036]     126500538    03029 Mitochondrial biogenesis [BR:mfot03029]     126500538   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mfot04812]     126500538    04147 Exosome [BR:mfot04147]     126500538 Transcription machinery [BR:mfot03021]  Eukaryotic type   RNA polymerase II system    Coactivators     BAF/PBAF complex      126500538 Messenger RNA biogenesis [BR:mfot03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      126500538 Chromosome and associated proteins [BR:mfot03036]  Eukaryotic type   Histone modification proteins    HAT complexes     TIP60 complex      126500538     NuA4 complex      126500538   Chromatin remodeling factors    BAF complex     126500538    PBAF complex     126500538    GBAF(ncBAF) complex     126500538    SWR1 complex     126500538 Mitochondrial biogenesis [BR:mfot03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Actin cytoskeleton organization     126500538 Cytoskeleton proteins [BR:mfot04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actins     Actins      126500538 Exosome [BR:mfot04147]  Exosomal proteins   Proteins found in most exosomes    126500538 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Actin Motif Other DBs NCBI-GeneID:  126500538 NCBI-ProteinID:  XP_049996472 LinkDB All DBs Position Unknown AA seq 375 aa AA seqDB search MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ EYDESGPSIVHRKCF NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt atggaagaagaaatcgccgcgctcgtcattgacaatggctccggcatgtgcaaagctggc tttgctggcgacgacgcccccagggccgtgttcccgtccatcgtcgggcgcccccgacac cagggcgtcatggtgggcatgggccagaaggactcgtacgtgggcgacgaggcccagagc aagcgaggcatcctgaccctgaagtaccccatcgagcacggcatcgtcaccaactgggac gacatggagaagatctggcaccacaccttctacaacgagctgcgtgtggcccccgaggag cacccggtgctgctcaccgaggcccccctgaaccccaaagcgaacagagagaagatgacg cagataatgtttgaaaccttcaacaccccagccatgtacgtggccattcaggcggtgttg tccctgtatgcgtctgggcgcaccactggcattgtcatggactctggtgacggggtcaca cacacagtgcccatctacgagggctacgcccttccccacgccatcttgcgtctggacctg gctggccgggacctgacagactacctcatgaagatcctgactgagcggggctacagcttc accaccacggctgagcgggaaatcgtgcgtgacattaaggagaagctgtgctacgttgcc ctggattttgagcaggaaatggccactgctgcatcatcctcttccttggagaagagctat gagctgcctgatgggcaggtgatcaccatcggcaatgagcggttccggtgtccagaggct ctcttccagccttccttcctgggcatggagtcctgtggcatccatgagaccaccttcaac tccatcatgaagtgcgacgtggacatccgcaaggacctgtatgccaacacggtgttgtcc ggtggtaccaccatgtacccaggcattgctgacaggatgcagaaggagatcacagcccta gcgcccagcacgatgaagatcaagatcatcgctccccctgagcgcaagtactccgtctgg atcggcggctccatcctggcctccctgtccaccttccagcagatgtggatcagcaagcag gagtatgacgagtcgggcccctccatcgtccaccgcaaatgcttctag

DBGET integrated database retrieval system