Alexandromys fortis (reed vole): 126506338 Help Entry 126506338         CDS       T08493                                  Name (RefSeq) C-X-C motif chemokine 3-like   KO K05505   C-X-C motif chemokine 1/2/3 Organism mfot  Alexandromys fortis (reed vole) Pathway mfot04060   Cytokine-cytokine receptor interaction mfot04061   Viral protein interaction with cytokine and cytokine receptor mfot04062   Chemokine signaling pathway mfot04064   NF-kappa B signaling pathway mfot04621   NOD-like receptor signaling pathway mfot04657   IL-17 signaling pathway mfot04668   TNF signaling pathway mfot04936   Alcoholic liver disease mfot05134   Legionellosis mfot05146   Amoebiasis mfot05167   Kaposi sarcoma-associated herpesvirus infection mfot05323   Rheumatoid arthritis mfot05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mfot00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     126506338    04668 TNF signaling pathway     126506338   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     126506338    04061 Viral protein interaction with cytokine and cytokine receptor     126506338  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     126506338    04657 IL-17 signaling pathway     126506338    04062 Chemokine signaling pathway     126506338  09160 Human Diseases   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     126506338   09171 Infectious disease: bacterial    05134 Legionellosis     126506338   09174 Infectious disease: parasitic    05146 Amoebiasis     126506338   09163 Immune disease    05323 Rheumatoid arthritis     126506338   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     126506338   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     126506338  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mfot04052]     126506338 Cytokines and neuropeptides [BR:mfot04052]  Cytokines   Chemokines    126506338 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  126506338 NCBI-ProteinID:  XP_050005804 LinkDB All DBs Position Unknown AA seq 102 aa AA seqDB search MAPATRPLLSAALLLLLLLATSHQATGTIMASELRCKCPKTIPRIALEEIQSLKVTPSGP HCTQTEVIATLKDGREVCLDPEGPRLQKIIQKILKTKTASSS NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atggccccagccacacgtcctctcctgagtgcagcgctgctgttgctgctgctgttggcc accagccaccaagctacagggacaattatggccagtgaactgcgctgtaagtgcccgaaa accataccaaggattgctttggaggaaatccagagcttgaaggtgacgccctcaggaccc cactgcacccagacagaagtcatagccactctcaaggatggtagagaagtttgtctggat cctgaaggccctaggcttcagaagatcatccaaaagatcctgaagacaaagaccgccagc tccagctga

DBGET integrated database retrieval system