Alexandromys fortis (reed vole): 126508433 Help Entry 126508433         CDS       T08493                                  Name (RefSeq) protein max isoform X1   KO K04453   Max protein Organism mfot  Alexandromys fortis (reed vole) Pathway mfot03083   Polycomb repressive complex mfot04010   MAPK signaling pathway mfot05200   Pathways in cancer mfot05202   Transcriptional misregulation in cancer mfot05222   Small cell lung cancer Brite KEGG Orthology (KO) [BR:mfot00001]  09120 Genetic Information Processing   09126 Chromosome    03083 Polycomb repressive complex     126508433  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     126508433  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     126508433    05202 Transcriptional misregulation in cancer     126508433   09162 Cancer: specific types    05222 Small cell lung cancer     126508433  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:mfot03000]     126508433    03036 Chromosome and associated proteins [BR:mfot03036]     126508433 Transcription factors [BR:mfot03000]  Eukaryotic type   Basic helix-loop-helix/leucine zipper (bHLH-ZIP)    Cell cycle controlling factors, Mad/Max     126508433 Chromosome and associated proteins [BR:mfot03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.6)      126508433 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  HLH JetA Filament bZIP_2 bHLH_INO4 SlyX SLX9 bHLH_INO2 DUF7801 GAGA_bind DUF4763 ATG16 XhlA Csm1_N Motif Other DBs NCBI-GeneID:  126508433 NCBI-ProteinID:  XP_050009633 LinkDB All DBs Position Unknown AA seq 160 aa AA seqDB search MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASR AQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDN SLYTNAKGGTISAFDGGSDSSSESEPEEPQSRKKLRMEAS NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgagcgataacgatgacatcgaggtggagagcgacgaagagcaaccgaggtttcaatct gcggctgacaaacgggctcaccataatgcactggaacgaaaacgtagggaccacatcaaa gacagctttcacagtttgcgggactcggtcccatcactccaaggagagaaggcatcccgg gcccaaatcttagacaaggcaacagagtatatccagtatatgcgaaggaaaaaccacacg caccagcaagacattgatgacctcaagcggcagaatgctcttctggagcagcaagtccgt gcactggagaaggcaaggtcaagtgcccaactgcagaccaactacccctcctcagacaac agcctctacaccaacgccaagggcggcaccatctctgccttcgatgggggttcagactcc agctcagagtccgagcctgaagagccccagagcaggaagaaactccggatggaggccagc taa

DBGET integrated database retrieval system