KEGG   Corallococcus macrosporus HW-1: LILAB_35665
Entry
LILAB_35665       CDS       T01558                                 
Name
(GenBank) NAD-dependent DNA ligase
  KO
K01972  DNA ligase (NAD+) [EC:6.5.1.2]
Organism
mfu  Corallococcus macrosporus HW-1
Pathway
mfu03030  DNA replication
mfu03410  Base excision repair
mfu03420  Nucleotide excision repair
mfu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mfu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    LILAB_35665
   03410 Base excision repair
    LILAB_35665
   03420 Nucleotide excision repair
    LILAB_35665
   03430 Mismatch repair
    LILAB_35665
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mfu03032]
    LILAB_35665
   03400 DNA repair and recombination proteins [BR:mfu03400]
    LILAB_35665
Enzymes [BR:mfu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.2  DNA ligase (NAD+)
     LILAB_35665
DNA replication proteins [BR:mfu03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     LILAB_35665
DNA repair and recombination proteins [BR:mfu03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA ligase
     LILAB_35665
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     LILAB_35665
   MMR (mismatch excision repair)
    DNA ligase
     LILAB_35665
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      LILAB_35665
SSDB
Motif
Pfam: DNA_ligase_aden DNA_ligase_OB HHH_2 HHH_5 BRCT DNA_ligase_ZBD Nlig-Ia PTCB-BRCT HHH RNA_pol_A_CTD BRCT_2 POLH-Rev1_HhH
Other DBs
NCBI-ProteinID: AEI69014
UniProt: F8CLX8
LinkDB
Position
8769221..8771239
AA seq 672 aa
MDDFQNAAARARELHRELAHHNYRYYVLDSPEVSDAQYDKLMRELQDLEARHPSLQTPDS
PTQRVGGAAAEAFGEVVHRAPMLSLANLFEDQGLIEFDERIRKLLGLPAISYVCEPKLDG
LAIALRYEKGAFVQGATRGDGTTGEDVTANLRTIRSLPMSLFPQDGVKVPEVLEVRGEVF
IRKKDFQKLNEKREEEGEPLFANPRNAAAGSLRQLDPRMTAARPLSVFLYECVPGEGVPA
FKTHIEKLEYLKTLGLPINQYRRAEGLEGVREAYDASLKGRHELPFEVDGMVVKVDDEDQ
RKRLGQVSKSPRWAVAYKFPPEEESTEVLDIGIQVGRTGALTPVAHLKPVKVGGVTVARA
TLHNEDELRRKDVRKGDTVFVRRAGDVIPEIVSVVLSRRPSDSAPFEFPRHCPVCHAVAT
KDEDGAIIRCTGASCPAQLVEKIRHFASRLAMDIEGLGDKLATQLVSTGSVKTFADLYAL
TKEKLLTLERMGDKSADNLVAALERSKQTTQRRFLYALGIRHVGDATAKALAEAFPQAEK
LFGASLEDISRVKDVGPIMAQVIHTFFQEPQNQEAIRALLAAGVQPAAPQVATGGPFVGK
SVVLTGAMTGMTREQAKEEVERRGGKVAGSVSRKTDFVVAGEDAGSKLKKAQELGVRILD
EQAFLQMLQTNA
NT seq 2019 nt   +upstreamnt  +downstreamnt
gtggacgacttccagaatgccgcagcccgagcccgtgagctccaccgtgagctggcgcac
cacaactaccgttactacgtcctcgactcgcccgaggtcagcgacgcgcaatacgacaag
ctgatgcgcgagctgcaggacctggaggcgcgacatccgagcctccagacgccggactcg
cccacccagcgcgtgggcggcgcggcggccgaggcgttcggcgaggtggtgcaccgggcg
cccatgctctcgctggccaacctcttcgaggaccagggcctcatcgagttcgacgagcgc
atccgcaagctgctgggcctgcccgccatctcctacgtctgcgagcccaagctggacggg
ctcgccatcgcgttgcgctacgaaaagggcgccttcgtccagggcgccacccggggtgac
ggcaccaccggcgaggacgtcaccgccaacctgcgcaccatccgcagcctgcccatgtcg
ctgttcccccaggacggcgtgaaggtgccggaggtgctggaggtgcgcggcgaggtcttc
atccgcaagaaggacttccagaagctcaacgagaagcgcgaggaggaaggcgagccgctc
ttcgccaacccgcgcaacgccgccgccggcagcctgcgccagttggacccgcgcatgacg
gccgcccgtcccctctccgtgttcctctacgaatgcgtccccggggagggggtccccgcc
ttcaagacgcacatcgagaagctggagtacctgaagacgctgggcctgcccatcaaccag
taccgccgcgccgagggcctggagggcgtgcgcgaggcgtatgacgcctccctgaagggc
cgccacgagttgcccttcgaggtggacggcatggtggtgaaggtggatgacgaggaccag
cgcaagcgcctgggccaggtctccaagagcccgcgctgggcggtggcctacaagttcccg
ccggaggaggagtccacggaggtgctggacatcggcatccaggtgggccgcacgggcgcg
ctgacgccggtggcgcacctgaagccggtgaaggtgggcggcgtcacggtggcgcgcgcc
acgctgcacaacgaggacgagctgcggcgcaaggacgtgcgcaagggcgacaccgtcttc
gtgcgccgcgccggcgacgtgattccggaaatcgtctccgtggtgctgtccaggcgcccg
tcggactccgcccccttcgagttccccaggcactgcccggtgtgccatgcggtggccacc
aaggacgaggacggggccatcatccgctgcacgggcgcctcgtgccccgcgcagctcgtg
gagaagatccgccacttcgccagccgcctggccatggacatcgagggcctgggggacaag
ctggccacgcagctggtgtccaccggcagcgtgaagaccttcgcggacctctacgcgctc
accaaagagaagctgctgacgctggagcgcatgggcgacaagagcgcggacaacctggtc
gcggcgctggagcgctccaagcagaccacgcagcggcgcttcctctacgccctgggcatc
cgccacgtgggtgacgccaccgccaaggcgctggcggaggccttcccccaggcggagaag
ctctttggcgccagcctggaggacatctcccgggtgaaggacgtgggccccatcatggcc
caggtcatccacaccttcttccaggagccgcagaaccaggaggccatccgcgcgctgctg
gcggcgggcgtccagcccgcggcgccccaggtcgccaccgggggccccttcgtgggcaag
tcggtggtgctcaccggcgcgatgacgggtatgacgcgggagcaggccaaggaggaggtc
gagcgccggggcggcaaggtcgccggaagtgtctcacgcaagaccgatttcgtggtggcg
ggcgaggatgcgggcagcaagctgaagaaggcccaggaactcggggtaagaatcctggac
gagcaggcgttcctgcagatgctgcagacgaacgcatag

DBGET integrated database retrieval system