Megalopta genalis: 117222585 Help Entry 117222585         CDS       T07400                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism mgen  Megalopta genalis Pathway mgen00510   N-Glycan biosynthesis mgen00513   Various types of N-glycan biosynthesis mgen04141   Protein processing in endoplasmic reticulum Module mgen_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:mgen00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     117222585    00513 Various types of N-glycan biosynthesis     117222585  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     117222585 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ost5 EI24 CAAD Pox_E2-like Motif Other DBs NCBI-GeneID:  117222585 NCBI-ProteinID:  XP_033330251 LinkDB All DBs Position Unknown AA seq 80 aa AA seqDB search MEEVDSLTRYVSPINPAIFPVLAVVLLGIGIFFTAWFFVYEVTSTKFTRDMIKELLISLV AALFSGFGVLFLLLWVGIYV NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggaggaagtcgattctctgacaagatatgtctctcccataaatcctgcgattttccca gttctagcagtggttttattaggaattggaatatttttcacagcatggttctttgtgtat gaagtcaccagcacaaaattcactagggatatgattaaagaattattaatttctctagtg gcagcattattttctgggttcggtgtattattcttacttctttgggtcggcatttacgta tag

DBGET integrated database retrieval system