KEGG   Mucilaginibacter ginsenosidivorans: FRZ54_22875
Entry
FRZ54_22875       CDS       T06123                                 
Symbol
fabG
Name
(GenBank) 3-oxoacyl-[acyl-carrier-protein] reductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
mgin  Mucilaginibacter ginsenosidivorans
Pathway
mgin00061  Fatty acid biosynthesis
mgin00780  Biotin metabolism
mgin01100  Metabolic pathways
mgin01110  Biosynthesis of secondary metabolites
mgin01212  Fatty acid metabolism
mgin01240  Biosynthesis of cofactors
Module
mgin_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:mgin00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    FRZ54_22875 (fabG)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    FRZ54_22875 (fabG)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    FRZ54_22875 (fabG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mgin01004]
    FRZ54_22875 (fabG)
Enzymes [BR:mgin01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     FRZ54_22875 (fabG)
Lipid biosynthesis proteins [BR:mgin01004]
 Fatty acid synthase
  Component type
   FRZ54_22875 (fabG)
SSDB
Motif
Pfam: adh_short_C2 adh_short KR SDR Epimerase 2-Hacid_dh_C
Other DBs
NCBI-ProteinID: QEC65292
UniProt: A0A5B8V208
LinkDB
Position
complement(5021338..5022081)
AA seq 247 aa
MKLLEGKTALITGASKGIGRKIAEKFAEHGANVAFTYLSSVEKGQALEQELQSYGTKVKG
YRSDASKFDEAEKLINDIIADFGTLQIVVNNAGITKDGLLMRMTEEQWDDVLDVNLKSIF
NVTKAASKIMMKNRDGVFINMSSVVGVNGNAGQSNYAASKAGIIGFSKSIAKELGSRNIR
TNVVAPGFIKTEMTEVLDPKVVEGWAQAIPLKRGGETEDVANACVFLASDMAAYITGQVI
PVDGGML
NT seq 744 nt   +upstreamnt  +downstreamnt
atgaaattactggaaggaaaaacagcactgataaccggcgcctcgaagggcataggccgt
aagatagccgagaaatttgccgagcatggcgcaaatgtagctttcacctacttgtcgtct
gtagaaaaagggcaggcgctggaacaggaactgcaaagctatggtaccaaagttaaaggt
taccggtctgacgcttccaaatttgatgaggccgaaaagctgatcaatgatatcatagcc
gatttcggcacgctgcaaattgtcgtaaacaacgccggcatcacaaaagatggtttactg
atgcgcatgaccgaagaacagtgggacgacgtattggatgtgaacctgaaatcgatattc
aatgtcaccaaagctgcatcaaagatcatgatgaagaaccgggatggcgtatttattaat
atgagctcggtagttggtgtcaacggtaatgccgggcaatccaactatgcagcatccaaa
gcaggtatcatcggtttctctaaatccatcgcaaaagaattaggttcaagaaatatacgc
accaacgtggtggcccctggttttatcaaaaccgaaatgaccgaagtgctggacccgaaa
gtagttgaaggctgggcgcaggccatcccactaaaacgtggcggcgaaaccgaagatgta
gccaatgcctgcgttttcctggcatcggacatggcggcatatattaccgggcaggtaatt
ccggttgacgggggaatgttgtag

DBGET integrated database retrieval system