Malassezia globosa: MGL_0788 Help Entry MGL_0788          CDS       T01043                                  Name (RefSeq) hypothetical protein   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism mgl  Malassezia globosa Pathway mgl03420   Nucleotide excision repair mgl04111   Cell cycle - yeast mgl04120   Ubiquitin mediated proteolysis mgl04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:mgl00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     MGL_0788    04120 Ubiquitin mediated proteolysis     MGL_0788   09124 Replication and repair    03420 Nucleotide excision repair     MGL_0788  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     MGL_0788  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:mgl04121]     MGL_0788    03400 DNA repair and recombination proteins [BR:mgl03400]     MGL_0788 Enzymes [BR:mgl01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      MGL_0788 Ubiquitin system [BR:mgl04121]  Ubiquitin ligases (E3)   UBL E3 ligases    MGL_0788   Multi subunit type E3    SCF complex     Ring finger protein      MGL_0788    Cul2 complex      MGL_0788    Cul3 complex      MGL_0788    Cul4 complex      MGL_0788    Cul7 complex      MGL_0788    Cul8 complex      MGL_0788    Cul9 complex      MGL_0788 DNA repair and recombination proteins [BR:mgl03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       MGL_0788     TCR (transcription coupled repair) factors      Cul4-CSA complex       MGL_0788 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-RING_11 PHD_NSD Motif Other DBs NCBI-GeneID:  5856501 NCBI-ProteinID:  XP_001732195 UniProt:  A8PUW7 LinkDB All DBs AA seq 113 aa AA seqDB search MSENAMHVEATHEGAPRFQVKKWNSVCLWSWDIQVDNCAICRNQIMDLCIECQANQGSAT IDECTVAWGACNHAFHFHCISRWLKTRPVCPLDNREWVLQKYVHTCHDLSWSY NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atgagtgagaatgcgatgcacgtcgaggccactcacgaaggtgcgcctcgattccaagtg aaaaagtggaatagcgtatgtctttggagctgggatatccaagtggacaactgcgctatc tgccggaatcagattatggatctctgtatcgagtgccaagcgaatcagggttccgccact attgacgaatgcactgtagcgtggggcgcttgcaatcatgcgtttcacttccattgtatc tcccgttggctgaaaacgcggcctgtgtgcccacttgataaccgcgaatgggtcctacaa aagtacgtgcacacatgccatgatctgagctggtcttactga

DBGET integrated database retrieval system