Meleagris gallopavo (turkey): 100548599 Help Entry 100548599         CDS       T01523                                  Symbol IL6 Name (RefSeq) interleukin-6   KO K05405   interleukin 6 Organism mgp  Meleagris gallopavo (turkey) Pathway mgp04060   Cytokine-cytokine receptor interaction mgp04068   FoxO signaling pathway mgp04218   Cellular senescence mgp04620   Toll-like receptor signaling pathway mgp04621   NOD-like receptor signaling pathway mgp04623   Cytosolic DNA-sensing pathway mgp04625   C-type lectin receptor signaling pathway mgp04672   Intestinal immune network for IgA production mgp05132   Salmonella infection mgp05164   Influenza A mgp05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:mgp00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     100548599 (IL6)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100548599 (IL6)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     100548599 (IL6)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100548599 (IL6)    04621 NOD-like receptor signaling pathway     100548599 (IL6)    04623 Cytosolic DNA-sensing pathway     100548599 (IL6)    04625 C-type lectin receptor signaling pathway     100548599 (IL6)    04672 Intestinal immune network for IgA production     100548599 (IL6)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     100548599 (IL6)    05168 Herpes simplex virus 1 infection     100548599 (IL6)   09171 Infectious disease: bacterial    05132 Salmonella infection     100548599 (IL6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mgp04052]     100548599 (IL6) Cytokines and neuropeptides [BR:mgp04052]  Cytokines   Interleukins    100548599 (IL6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL6 GCSF IL11 IL23 Motif Other DBs NCBI-GeneID:  100548599 NCBI-ProteinID:  XP_003207178 Ensembl:  ENSMGAG00000016678 LinkDB All DBs Position 6:29929594..29932024 Genome browser AA seq 162 aa AA seqDB search SDATATLGVSPQMCEKFSVCENSMEMLVRNNLNLPKVTEEDGCLLAGFDEEKCLRKLSSG LFAFQTYLEFIQETFASEKQNVESLCYGTKHLAATIRQMVINPDEVVIPDSATQKSLLAK LKSDKAWIEKITTHLILRDFTSFMEKTVRAVRYLKNTRSFSA NT seq 489 nt NT seq  +upstreamnt  +downstreamnt tcggacgcgacggcaactctcggtgtctctccgcagatgtgcgagaagttctccgtctgc gagaacagcatggagatgctcgtccggaacaacctcaacctgcccaaggtgacggaggag gacggctgcctgctcgccggcttcgacgaggagaaatgcctgaggaagctctccagcggc ctgttcgcctttcagacctatctggaattcattcaagaaacttttgctagcgaaaagcag aatgtcgaatcgctgtgctacggcacaaagcacctggcggccacgatccggcagatggtg ataaatcccgatgaagtggtcatcccagactcagccacccagaaatccctcctcgccaag ctgaagtcagataaggcgtggatagagaagatcaccacgcacctcatcctccgtgacttt acttcgtttatggagaagaccgtgagggccgttcgctatttgaaaaacaccaggagtttc agtgcctga

DBGET integrated database retrieval system