Pyricularia oryzae: MGG_08844 Help Entry MGG_08844         CDS       T01027                                  Name (RefSeq) RING-box protein 1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism mgr  Pyricularia oryzae Pathway mgr03420   Nucleotide excision repair mgr04111   Cell cycle - yeast mgr04120   Ubiquitin mediated proteolysis mgr04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:mgr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     MGG_08844    04120 Ubiquitin mediated proteolysis     MGG_08844   09124 Replication and repair    03420 Nucleotide excision repair     MGG_08844  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     MGG_08844  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:mgr04121]     MGG_08844    03400 DNA repair and recombination proteins [BR:mgr03400]     MGG_08844 Enzymes [BR:mgr01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      MGG_08844 Ubiquitin system [BR:mgr04121]  Ubiquitin ligases (E3)   UBL E3 ligases    MGG_08844   Multi subunit type E3    SCF complex     Ring finger protein      MGG_08844    Cul2 complex      MGG_08844    Cul3 complex      MGG_08844    Cul4 complex      MGG_08844    Cul7 complex      MGG_08844    Cul8 complex      MGG_08844    Cul9 complex      MGG_08844 DNA repair and recombination proteins [BR:mgr03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       MGG_08844     TCR (transcription coupled repair) factors      Cul4-CSA complex       MGG_08844 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-RING_11 Motif Other DBs NCBI-GeneID:  2679830 NCBI-ProteinID:  XP_003713864 UniProt:  G4MV42 LinkDB All DBs Position 2:complement(1839418..1840700) Genome browser AA seq 119 aa AA seqDB search MADVDMTDAPGGAGPVAKKKGGDGAAGEGKKRFEVKKWNAVALWAWDIVVDNCAICRNHI MDLCIECQANQASATSEECTVAWGICNHAFHFHCISRWLKARQVCPLDNRDWEFQKYGR NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggccgacgttgacatgacagacgcgccaggtggcgcaggccctgtggccaagaagaag ggcggcgatggcgccgcgggcgaaggaaagaagcgattcgaggtcaagaagtggaacgcc gttgcgctctgggcttgggacattgtcgtcgacaactgcgccatctgcaggaatcacatc atggatctttgtattgaatgccaggcaaaccaagcatccgccacgagcgaggagtgcact gttgcctggggtatctgcaatcacgctttccacttccactgcatctcaaggtggctgaag gcacgacaggtctgtcccctggataaccgtgactgggaattccagaaatatggtcgttga

DBGET integrated database retrieval system