Pyricularia oryzae: MGG_16841 Help Entry MGG_16841         CDS       T01027                                  Name (RefSeq) hypothetical protein   KO K12622   U6 snRNA-associated Sm-like protein LSm3 Organism mgr  Pyricularia oryzae Pathway mgr03018   RNA degradation mgr03040   Spliceosome Brite KEGG Orthology (KO) [BR:mgr00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     MGG_16841   09123 Folding, sorting and degradation    03018 RNA degradation     MGG_16841  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:mgr03019]     MGG_16841    03041 Spliceosome [BR:mgr03041]     MGG_16841 Messenger RNA biogenesis [BR:mgr03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      MGG_16841   mRNA degradation factors    5'-3' decay     Lsm complex      MGG_16841 Spliceosome [BR:mgr03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     MGG_16841  Complex C   U2 snRNP components     MGG_16841 SSDB OrthologParalogGFIT Motif Pfam:  LSM YopQ Motif Other DBs NCBI-GeneID:  12985068 NCBI-ProteinID:  XP_003712525 UniProt:  G4N3U5 LinkDB All DBs Position 3:complement(4330165..4331212) Genome browser AA seq 95 aa AA seqDB search MADSGEAQANEPFGLVRLLLDEVVFVKLRGDRELKGRLHAYDSHCNLVLGDVEETHYIQD EDDESELKTVSRKLEMLFVRGDSVVMISPSDQVAA NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggcggacagcggtgaggctcaagccaatgagccttttggcttggtgaggcttctgttg gacgaggttgtgtttgtcaagcttcgaggagacagagagctcaagggccgtttgcatgca tacgattctcattgcaacttggtcctcggtgatgtcgaagaaacacattacattcaggac gaggacgatgagtcggaactgaagactgtgtcacgaaagcttgagatgttattcgtgaga ggagacagtgttgtcatgatatcaccatcagaccaggtagcagcatga

DBGET integrated database retrieval system