Methanosarcina hadiensis: RSJ42_05160 Help Entry RSJ42_05160       CDS       T10775                                  Name (GenBank) ferredoxin family protein   KO K00188   2-oxoisovalerate ferredoxin oxidoreductase delta subunit [EC:1.2.7.7] Organism mhab  Methanosarcina hadiensis Pathway mhab00280   Valine, leucine and isoleucine degradation mhab01100   Metabolic pathways mhab01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:mhab00001]  09100 Metabolism   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     RSJ42_05160 Enzymes [BR:mhab01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.7  3-methyl-2-oxobutanoate dehydrogenase (ferredoxin)      RSJ42_05160 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_7 Fer4_21 Fer4_9 Fer4_2 Fer4_10 Fer4_17 Fer4 Fer4_8 LdpA_Fe-S-bd Fer4_4 Fer4_6 Fer4_16 Fer4_22 Fer4_3 Fer4_13 Motif Other DBs NCBI-ProteinID:  XMB90189 LinkDB All DBs Position 1181215..1181463 Genome browser AA seq 82 aa AA seqDB search MAKNDQKEPYPVINILECKACGRCLLACPKDVLFMSENLNARGYHYIEYKGEGCSGCASC YYTCPEPLALEIHIPLKKEDAE NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggcaaaaaatgatcaaaaggaaccgtaccctgttatcaatattctggagtgcaaggca tgcgggcgctgcctgcttgcctgtcccaaagatgtacttttcatgagcgagaacctgaac gcgcggggttaccactacatagagtataaaggagaaggctgctcaggctgtgcgagctgc tattatacctgccctgaacccctggcactcgaaatccatattcccctgaaaaaggaggat gccgaataa

DBGET integrated database retrieval system