Mangifera indica (mango): 123194309 Help Entry 123194309         CDS       T07684                                  Name (RefSeq) transmembrane protein 258-like   KO K26502   transmembrane protein 258 Organism minc  Mangifera indica (mango) Pathway minc00510   N-Glycan biosynthesis minc00513   Various types of N-glycan biosynthesis minc04141   Protein processing in endoplasmic reticulum Module minc_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:minc00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     123194309    00513 Various types of N-glycan biosynthesis     123194309  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     123194309 SSDB OrthologParalogGFIT Motif Pfam:  Ost5 VTC5_C Motif Other DBs NCBI-GeneID:  123194309 NCBI-ProteinID:  XP_044463417 LinkDB All DBs Position 13:complement(10589758..10592181) Genome browser AA seq 76 aa AA seqDB search MAPKPITSPVPEAWYPTVSVFMLSFGLLVTASFFIYEATSSRQNRILAKELITGAIASVF LGCGSLFLLLASGIYV NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggctccaaaacctattacaagtccagtgccggaagcttggtaccctaccgtatctgtg ttcatgctttcgttcggtcttctcgtcactgcttcattcttcatttatgaagcaacctct tctaggcaaaaccgcattcttgccaaggagcttataacaggagcaatagcatctgtcttc ctaggttgcgggtccttattcttgctgcttgcttctggcatatatgtttaa

DBGET integrated database retrieval system