Manis javanica (Malayan pangolin): 108387631 Help Entry 108387631         CDS       T06054                                  Symbol CDK4 Name (RefSeq) cyclin-dependent kinase 4   KO K02089   cyclin-dependent kinase 4 [EC:2.7.11.22] Organism mjv  Manis javanica (Malayan pangolin) Pathway mjv01522   Endocrine resistance mjv04110   Cell cycle mjv04115   p53 signaling pathway mjv04151   PI3K-Akt signaling pathway mjv04218   Cellular senescence mjv04530   Tight junction mjv04660   T cell receptor signaling pathway mjv04933   AGE-RAGE signaling pathway in diabetic complications mjv04934   Cushing syndrome mjv05160   Hepatitis C mjv05162   Measles mjv05163   Human cytomegalovirus infection mjv05164   Influenza A mjv05165   Human papillomavirus infection mjv05166   Human T-cell leukemia virus 1 infection mjv05167   Kaposi sarcoma-associated herpesvirus infection mjv05169   Epstein-Barr virus infection mjv05200   Pathways in cancer mjv05203   Viral carcinogenesis mjv05212   Pancreatic cancer mjv05214   Glioma mjv05218   Melanoma mjv05219   Bladder cancer mjv05220   Chronic myeloid leukemia mjv05222   Small cell lung cancer mjv05223   Non-small cell lung cancer mjv05224   Breast cancer mjv05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:mjv00001]  09130 Environmental Information Processing   09132 Signal transduction    04151 PI3K-Akt signaling pathway     108387631 (CDK4)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     108387631 (CDK4)    04115 p53 signaling pathway     108387631 (CDK4)    04218 Cellular senescence     108387631 (CDK4)   09144 Cellular community - eukaryotes    04530 Tight junction     108387631 (CDK4)  09150 Organismal Systems   09151 Immune system    04660 T cell receptor signaling pathway     108387631 (CDK4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     108387631 (CDK4)    05203 Viral carcinogenesis     108387631 (CDK4)   09162 Cancer: specific types    05212 Pancreatic cancer     108387631 (CDK4)    05225 Hepatocellular carcinoma     108387631 (CDK4)    05214 Glioma     108387631 (CDK4)    05220 Chronic myeloid leukemia     108387631 (CDK4)    05218 Melanoma     108387631 (CDK4)    05219 Bladder cancer     108387631 (CDK4)    05224 Breast cancer     108387631 (CDK4)    05222 Small cell lung cancer     108387631 (CDK4)    05223 Non-small cell lung cancer     108387631 (CDK4)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     108387631 (CDK4)    05160 Hepatitis C     108387631 (CDK4)    05164 Influenza A     108387631 (CDK4)    05162 Measles     108387631 (CDK4)    05163 Human cytomegalovirus infection     108387631 (CDK4)    05167 Kaposi sarcoma-associated herpesvirus infection     108387631 (CDK4)    05169 Epstein-Barr virus infection     108387631 (CDK4)    05165 Human papillomavirus infection     108387631 (CDK4)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     108387631 (CDK4)    04934 Cushing syndrome     108387631 (CDK4)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     108387631 (CDK4)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:mjv01001]     108387631 (CDK4) Enzymes [BR:mjv01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.22  cyclin-dependent kinase      108387631 (CDK4) Protein kinases [BR:mjv01001]  Serine/threonine kinases: CMGC group   CDK family    108387631 (CDK4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH Kdo ABC1 Haspin_kinase Kinase-like Motif Other DBs NCBI-GeneID:  108387631 NCBI-ProteinID:  XP_017501482 LinkDB All DBs Position Unknown AA seq 303 aa AA seqDB search MATPRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGAGGGLPISTVREVALL RRLEAFEHPNVVRLMDVCATARTDRETKVTLVFEHVDQDLRTYLDKAPPPGLPVETIKDV MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPDDDWPR DVSLPRGAFSPRGPRPVQSAVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLQKAEG NPE NT seq 912 nt NT seq  +upstreamnt  +downstreamnt atggctacccctcggtatgagccagtggctgaaattggtgttggtgcctatgggacggtg tacaaggcccgtgatccccacagtggccacttcgtggccctcaagagcgtgagagtcccc aatggaggaggtgctggaggaggccttccaatcagcacagttcgtgaggtggccttactg aggcggctggaggcttttgagcatcccaatgttgttcgattgatggacgtctgtgccaca gcccgaactgaccgggaaaccaaagtgaccctggtgtttgagcatgtggaccaagaccta aggacatatctggacaaagcacccccaccaggcttgccagtggagaccatcaaggatgtg atgcgccagtttttaagaggcctggatttccttcatgccaactgcattgttcaccgagat ctgaagccagagaacattctggtgacaagtggtgggacagtcaagttggctgactttggc ctggccagaatctacagctaccagatggcacttacacctgtggttgttacactatggtac cgtgctccagaagttcttctacagtctacatatgcaacacctgtggacatgtggagtgtt ggctgtatctttgcagagatgtttcgtcgaaagcctctcttctgtggaaactctgaagct gaccagttaggcaaaatctttgacctgatcgggctgcccccagacgatgactggccccga gatgtgtctctaccccgaggagccttttcccccagagggccccgcccagtgcagtctgcg gttcctgagatggaagagtctggagcacagctgctgctggagatgctgacttttaaccca cacaagcggatctctgccttccgagccctgcagcactcttatctacaaaaggcagaaggt aacccagagtga

DBGET integrated database retrieval system