Manis javanica (Malayan pangolin): 108390065 Help Entry 108390065         CDS       T06054                                  Symbol IL4 Name (RefSeq) interleukin-4   KO K05430   interleukin 4 Organism mjv  Manis javanica (Malayan pangolin) Pathway mjv04060   Cytokine-cytokine receptor interaction mjv04151   PI3K-Akt signaling pathway mjv04630   JAK-STAT signaling pathway mjv04640   Hematopoietic cell lineage mjv04657   IL-17 signaling pathway mjv04658   Th1 and Th2 cell differentiation mjv04659   Th17 cell differentiation mjv04660   T cell receptor signaling pathway mjv04664   Fc epsilon RI signaling pathway mjv04672   Intestinal immune network for IgA production mjv05140   Leishmaniasis mjv05200   Pathways in cancer mjv05310   Asthma mjv05320   Autoimmune thyroid disease mjv05321   Inflammatory bowel disease mjv05330   Allograft rejection Brite KEGG Orthology (KO) [BR:mjv00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     108390065 (IL4)    04151 PI3K-Akt signaling pathway     108390065 (IL4)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     108390065 (IL4)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     108390065 (IL4)    04660 T cell receptor signaling pathway     108390065 (IL4)    04658 Th1 and Th2 cell differentiation     108390065 (IL4)    04659 Th17 cell differentiation     108390065 (IL4)    04657 IL-17 signaling pathway     108390065 (IL4)    04664 Fc epsilon RI signaling pathway     108390065 (IL4)    04672 Intestinal immune network for IgA production     108390065 (IL4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     108390065 (IL4)   09174 Infectious disease: parasitic    05140 Leishmaniasis     108390065 (IL4)   09163 Immune disease    05310 Asthma     108390065 (IL4)    05320 Autoimmune thyroid disease     108390065 (IL4)    05321 Inflammatory bowel disease     108390065 (IL4)    05330 Allograft rejection     108390065 (IL4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mjv04052]     108390065 (IL4)    00536 Glycosaminoglycan binding proteins [BR:mjv00536]     108390065 (IL4) Cytokines and neuropeptides [BR:mjv04052]  Cytokines   Interleukins    108390065 (IL4) Glycosaminoglycan binding proteins [BR:mjv00536]  Heparan sulfate / Heparin   Cytokines    108390065 (IL4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL4 Motif Other DBs NCBI-GeneID:  108390065 NCBI-ProteinID:  XP_017504172 LinkDB All DBs Position Unknown AA seq 134 aa AA seqDB search MGLTSQLIPTLVCFLAFTSNFIHGHKRGVALLEIIRTLNILTARNDPCMELTIQDTFAAP KNTTEKETFCRAANALRQFYKEHKCWRRLLSGLDRNLSSTANTTFCPMKEAKKSTLKDFL ERLKMNMKRKYSKY NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atgggtctcacctcccaactgattccaaccctggtctgctttctagcattcaccagcaac ttcatccacggacacaagaggggtgttgccttactggagatcatcagaacgctgaacatc ctcacagcgagaaacgatccatgcatggagctgactatacaggacaccttcgctgcccca aagaacacaactgagaaggaaaccttctgcagggctgcaaatgcgcttcggcagttctat aaagagcacaagtgctggcgcagacttttgagcggacttgacaggaacctcagcagcacg gcaaacacgaccttctgtcctatgaaggaggccaagaagagcacattgaaagacttcctg gaaaggctaaagatgaacatgaaaaggaaatactcaaagtattga

DBGET integrated database retrieval system