Manis javanica (Malayan pangolin): 108402534 Help Entry 108402534         CDS       T06054                                  Symbol FOS Name (RefSeq) proto-oncogene c-Fos   KO K04379   proto-oncogene protein c-fos Organism mjv  Manis javanica (Malayan pangolin) Pathway mjv01522   Endocrine resistance mjv04010   MAPK signaling pathway mjv04024   cAMP signaling pathway mjv04210   Apoptosis mjv04380   Osteoclast differentiation mjv04620   Toll-like receptor signaling pathway mjv04657   IL-17 signaling pathway mjv04658   Th1 and Th2 cell differentiation mjv04659   Th17 cell differentiation mjv04660   T cell receptor signaling pathway mjv04662   B cell receptor signaling pathway mjv04668   TNF signaling pathway mjv04713   Circadian entrainment mjv04725   Cholinergic synapse mjv04728   Dopaminergic synapse mjv04915   Estrogen signaling pathway mjv04917   Prolactin signaling pathway mjv04921   Oxytocin signaling pathway mjv04926   Relaxin signaling pathway mjv04928   Parathyroid hormone synthesis, secretion and action mjv04932   Non-alcoholic fatty liver disease mjv04935   Growth hormone synthesis, secretion and action mjv05031   Amphetamine addiction mjv05132   Salmonella infection mjv05133   Pertussis mjv05135   Yersinia infection mjv05140   Leishmaniasis mjv05142   Chagas disease mjv05161   Hepatitis B mjv05162   Measles mjv05166   Human T-cell leukemia virus 1 infection mjv05167   Kaposi sarcoma-associated herpesvirus infection mjv05170   Human immunodeficiency virus 1 infection mjv05171   Coronavirus disease - COVID-19 mjv05200   Pathways in cancer mjv05207   Chemical carcinogenesis - receptor activation mjv05208   Chemical carcinogenesis - reactive oxygen species mjv05210   Colorectal cancer mjv05224   Breast cancer mjv05231   Choline metabolism in cancer mjv05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mjv05323   Rheumatoid arthritis mjv05417   Lipid and atherosclerosis mjv05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mjv00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     108402534 (FOS)    04668 TNF signaling pathway     108402534 (FOS)    04024 cAMP signaling pathway     108402534 (FOS)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     108402534 (FOS)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     108402534 (FOS)    04660 T cell receptor signaling pathway     108402534 (FOS)    04658 Th1 and Th2 cell differentiation     108402534 (FOS)    04659 Th17 cell differentiation     108402534 (FOS)    04657 IL-17 signaling pathway     108402534 (FOS)    04662 B cell receptor signaling pathway     108402534 (FOS)   09152 Endocrine system    04915 Estrogen signaling pathway     108402534 (FOS)    04917 Prolactin signaling pathway     108402534 (FOS)    04921 Oxytocin signaling pathway     108402534 (FOS)    04926 Relaxin signaling pathway     108402534 (FOS)    04935 Growth hormone synthesis, secretion and action     108402534 (FOS)    04928 Parathyroid hormone synthesis, secretion and action     108402534 (FOS)   09156 Nervous system    04725 Cholinergic synapse     108402534 (FOS)    04728 Dopaminergic synapse     108402534 (FOS)   09158 Development and regeneration    04380 Osteoclast differentiation     108402534 (FOS)   09159 Environmental adaptation    04713 Circadian entrainment     108402534 (FOS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     108402534 (FOS)    05207 Chemical carcinogenesis - receptor activation     108402534 (FOS)    05208 Chemical carcinogenesis - reactive oxygen species     108402534 (FOS)    05231 Choline metabolism in cancer     108402534 (FOS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     108402534 (FOS)   09162 Cancer: specific types    05210 Colorectal cancer     108402534 (FOS)    05224 Breast cancer     108402534 (FOS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     108402534 (FOS)    05170 Human immunodeficiency virus 1 infection     108402534 (FOS)    05161 Hepatitis B     108402534 (FOS)    05171 Coronavirus disease - COVID-19     108402534 (FOS)    05162 Measles     108402534 (FOS)    05167 Kaposi sarcoma-associated herpesvirus infection     108402534 (FOS)   09171 Infectious disease: bacterial    05132 Salmonella infection     108402534 (FOS)    05135 Yersinia infection     108402534 (FOS)    05133 Pertussis     108402534 (FOS)   09174 Infectious disease: parasitic    05140 Leishmaniasis     108402534 (FOS)    05142 Chagas disease     108402534 (FOS)   09163 Immune disease    05323 Rheumatoid arthritis     108402534 (FOS)   09165 Substance dependence    05031 Amphetamine addiction     108402534 (FOS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     108402534 (FOS)    05418 Fluid shear stress and atherosclerosis     108402534 (FOS)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     108402534 (FOS)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     108402534 (FOS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:mjv03000]     108402534 (FOS)    04131 Membrane trafficking [BR:mjv04131]     108402534 (FOS) Transcription factors [BR:mjv03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     108402534 (FOS) Membrane trafficking [BR:mjv04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     108402534 (FOS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf HALZ Macoilin Motif Other DBs NCBI-GeneID:  108402534 NCBI-ProteinID:  XP_017524628 LinkDB All DBs Position Unknown AA seq 380 aa AA seqDB search MMFSGFNADYEASSSRCSSASPAGDNLSYYHSPAESFSSMGSPVNAQDFCTDLAVSSASF IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPAPSAGAYARAGVVKTMTGGRT QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ TEIASLLKEKEKLEFILAAHRPACKIPNDLGFPEEMSVASLDLSGALPEAATPEAEEAFT LPLLNDPEPKPSVEPAKSISSMELKAEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA ADWEPLHGGSLGMGPMATELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCAAAHRK GSSSNEPSSDSLSSPTLLAL NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt atgatgttctccggcttcaacgccgactacgaggcgtcctcctcccgctgcagcagcgcc tccccagccggggacaacctctcctactaccactcaccggccgagtccttctccagcatg ggatctcctgtcaatgctcaggacttctgcacagatctggcagtctccagtgccagcttc atcccaacggtgacggccatctccaccagtccggacctgcagtggctggtgcagcccaca ctggtctcctccgtggccccatcccagaccagagctcctcacccctatggagtccctgct ccctccgctggggcttacgccagggctggagtcgtgaagaccatgacaggagggagaact cagagcattggcaggaggggcaaggtggaacagttgtccccagaagaagaagaaaaaagg agaatccgaagggaaaggaataagatggctgcagccaaatgcaggaaccggaggagggag ctgactgacacgctccaagcggagacagaccaattagaagatgagaagtctgctttgcag acggagattgccagcttgctgaaggagaaggaaaaactggagttcatcttggcagctcac cgacctgcctgcaagatccctaatgacctgggcttcccagaggagatgtctgtggcttct cttgatctgagtggggccctgcccgaggctgccacccccgaggctgaggaggccttcacc ctaccgctcctcaatgatcctgagcccaagccctcagtggagcctgccaagagcattagc agcatggagctaaaggccgagccttttgatgacttcctgttcccagcatcgtccaggccc agcggctctgagaccgcccgctctgtgccagacatggacctgtctggttccttctatgca gcagactgggagcccctgcatggtgggtccctggggatggggcccatggccacagagctg gagcccctgtgcaccccagtggtcacctgtactcccagctgcaccacgtacacgtcttct ttcgtcttcacctaccccgaggctgactccttccccagctgtgcggctgcccaccgcaag ggcagcagcagcaatgagccctcctctgactcgctcagctcacctacgctgctggccctg tga

DBGET integrated database retrieval system