Manis javanica (Malayan pangolin): 118974052 Help Entry 118974052         CDS       T06054                                  Name (RefSeq) cellular tumor antigen p53   KO K04451   tumor protein p53 Organism mjv  Manis javanica (Malayan pangolin) Pathway mjv01522   Endocrine resistance mjv01524   Platinum drug resistance mjv04010   MAPK signaling pathway mjv04071   Sphingolipid signaling pathway mjv04110   Cell cycle mjv04115   p53 signaling pathway mjv04137   Mitophagy - animal mjv04151   PI3K-Akt signaling pathway mjv04210   Apoptosis mjv04211   Longevity regulating pathway mjv04216   Ferroptosis mjv04218   Cellular senescence mjv04310   Wnt signaling pathway mjv04722   Neurotrophin signaling pathway mjv04919   Thyroid hormone signaling pathway mjv05012   Parkinson disease mjv05014   Amyotrophic lateral sclerosis mjv05016   Huntington disease mjv05160   Hepatitis C mjv05161   Hepatitis B mjv05162   Measles mjv05163   Human cytomegalovirus infection mjv05165   Human papillomavirus infection mjv05166   Human T-cell leukemia virus 1 infection mjv05167   Kaposi sarcoma-associated herpesvirus infection mjv05168   Herpes simplex virus 1 infection mjv05169   Epstein-Barr virus infection mjv05200   Pathways in cancer mjv05202   Transcriptional misregulation in cancer mjv05203   Viral carcinogenesis mjv05205   Proteoglycans in cancer mjv05206   MicroRNAs in cancer mjv05210   Colorectal cancer mjv05212   Pancreatic cancer mjv05213   Endometrial cancer mjv05214   Glioma mjv05215   Prostate cancer mjv05216   Thyroid cancer mjv05217   Basal cell carcinoma mjv05218   Melanoma mjv05219   Bladder cancer mjv05220   Chronic myeloid leukemia mjv05222   Small cell lung cancer mjv05223   Non-small cell lung cancer mjv05224   Breast cancer mjv05225   Hepatocellular carcinoma mjv05226   Gastric cancer mjv05230   Central carbon metabolism in cancer mjv05417   Lipid and atherosclerosis mjv05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mjv00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     118974052    04310 Wnt signaling pathway     118974052    04071 Sphingolipid signaling pathway     118974052    04151 PI3K-Akt signaling pathway     118974052  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     118974052   09143 Cell growth and death    04110 Cell cycle     118974052    04210 Apoptosis     118974052    04216 Ferroptosis     118974052    04115 p53 signaling pathway     118974052    04218 Cellular senescence     118974052  09150 Organismal Systems   09152 Endocrine system    04919 Thyroid hormone signaling pathway     118974052   09156 Nervous system    04722 Neurotrophin signaling pathway     118974052   09149 Aging    04211 Longevity regulating pathway     118974052  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     118974052    05202 Transcriptional misregulation in cancer     118974052    05206 MicroRNAs in cancer     118974052    05205 Proteoglycans in cancer     118974052    05203 Viral carcinogenesis     118974052    05230 Central carbon metabolism in cancer     118974052   09162 Cancer: specific types    05210 Colorectal cancer     118974052    05212 Pancreatic cancer     118974052    05225 Hepatocellular carcinoma     118974052    05226 Gastric cancer     118974052    05214 Glioma     118974052    05216 Thyroid cancer     118974052    05220 Chronic myeloid leukemia     118974052    05217 Basal cell carcinoma     118974052    05218 Melanoma     118974052    05219 Bladder cancer     118974052    05215 Prostate cancer     118974052    05213 Endometrial cancer     118974052    05224 Breast cancer     118974052    05222 Small cell lung cancer     118974052    05223 Non-small cell lung cancer     118974052   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     118974052    05161 Hepatitis B     118974052    05160 Hepatitis C     118974052    05162 Measles     118974052    05168 Herpes simplex virus 1 infection     118974052    05163 Human cytomegalovirus infection     118974052    05167 Kaposi sarcoma-associated herpesvirus infection     118974052    05169 Epstein-Barr virus infection     118974052    05165 Human papillomavirus infection     118974052   09164 Neurodegenerative disease    05012 Parkinson disease     118974052    05014 Amyotrophic lateral sclerosis     118974052    05016 Huntington disease     118974052   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     118974052    05418 Fluid shear stress and atherosclerosis     118974052   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     118974052    01522 Endocrine resistance     118974052  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:mjv03000]     118974052    03036 Chromosome and associated proteins [BR:mjv03036]     118974052    03400 DNA repair and recombination proteins [BR:mjv03400]     118974052 Transcription factors [BR:mjv03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    p53     118974052 Chromosome and associated proteins [BR:mjv03036]  Eukaryotic type   Sister chromatid separation proteins    Aurora kinases     Regulators of Aurora kinases      118974052 DNA repair and recombination proteins [BR:mjv03400]  Eukaryotic type   Check point factors    Other check point factors     118974052 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  P53 P53_tetramer P53_TAD CEP1-DNA_bind Motif Other DBs NCBI-GeneID:  118974052 NCBI-ProteinID:  XP_036882972 LinkDB All DBs Position Unknown AA seq 384 aa AA seqDB search MEHQQSELNIEPPLSQETFSDLWKLLPENNVLSSELSPLSPEVDKLLLSTEDIVNWLGEG PDEAPAPAAPAPAAPASATSWPLSSFVPSQKTYPGRYGFHLGFLHSGTAKSVTCTYSPSL NKLFCQLAKTCPVQLWVSSPPPPGTRVRAMAIYKKSEYMTEVVRRCPHHERCSDYSDGLA PPQHLIRVEGNLRAEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNFMCNSSCMGGMNRR PILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENSRKKGEPRPEPPPGSTKRALP SNSSSSPSQKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQTGKEAGGSRAHSSHL KSKKGQSTSRHKKLMFKREGPDSD NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt atggagcatcagcagtcagaactcaacattgagccccctctgagccaggagaccttttca gacttgtggaaactacttcccgaaaacaatgtgctgtcctctgagctgtccccactgtcc ccagaggtggacaaactgctgctgtccacagaagacattgtgaactggttaggagaaggt ccagatgaagctcctgcaccagcagctcctgcaccagcagccccggcatcagccacttca tggcccctgtcatcctttgtcccttcccagaagacctaccctggcagatatggtttccat ttagggttcctgcattccgggacagccaagtctgttacctgcacgtactccccttccctc aacaaactgttttgccagctggcaaagacctgcccagtgcagctgtgggtcagctcgcca cccccgcccggcacccgtgtccgcgccatggccatctacaaaaagtcagagtacatgaca gaggtggtgaggcgctgcccccaccatgaacgctgctctgactacagtgatggtctggcc ccccctcagcatctcatccgggtggaaggaaatttgcgtgctgagtatttggatgacagg aacacttttcgacatagtgtggtggtgccttatgagccacctgaggtcggctctgactgt accaccatccactacaacttcatgtgtaacagttcctgcatgggtggcatgaaccggcgg cccatcctcaccatcatcacactggaggactccagtggcaatctgctgggacggaacagc tttgaggtgcgtgtttgtgcctgtcctgggagagatcggcgcacagaggaagaaaactcc cgcaagaaaggggagccccgccccgagccaccccctgggagcaccaagcgagcactgccc agcaactccagttcctctccctcacaaaagaagaagccactggacggagaatattttacc cttcagatccgtgggcgtgaacgctttgagatgttcagagagctgaatgaagccttggag ctgaaggatgcccagactggaaaagaggccgggggtagcagggcccactccagccacctg aagtctaagaaggggcagtctacctcccgccataaaaaactgatgttcaagagagaaggg cctgactcagactga

DBGET integrated database retrieval system