Macrotis lagotis (bilby): 141514920 Help Entry 141514920         CDS       T11097                                  Symbol RAP1B Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism mlao  Macrotis lagotis (bilby) Pathway mlao04010   MAPK signaling pathway mlao04014   Ras signaling pathway mlao04015   Rap1 signaling pathway mlao04024   cAMP signaling pathway mlao04062   Chemokine signaling pathway mlao04510   Focal adhesion mlao04517   IgSF CAM signaling mlao04520   Adherens junction mlao04611   Platelet activation mlao04670   Leukocyte transendothelial migration mlao04720   Long-term potentiation mlao04722   Neurotrophin signaling pathway mlao04934   Cushing syndrome mlao04972   Pancreatic secretion mlao05211   Renal cell carcinoma mlao05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mlao00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     141514920 (RAP1B)    04014 Ras signaling pathway     141514920 (RAP1B)    04015 Rap1 signaling pathway     141514920 (RAP1B)    04024 cAMP signaling pathway     141514920 (RAP1B)   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     141514920 (RAP1B)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     141514920 (RAP1B)    04520 Adherens junction     141514920 (RAP1B)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     141514920 (RAP1B)    04670 Leukocyte transendothelial migration     141514920 (RAP1B)    04062 Chemokine signaling pathway     141514920 (RAP1B)   09154 Digestive system    04972 Pancreatic secretion     141514920 (RAP1B)   09156 Nervous system    04720 Long-term potentiation     141514920 (RAP1B)    04722 Neurotrophin signaling pathway     141514920 (RAP1B)  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     141514920 (RAP1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     141514920 (RAP1B)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     141514920 (RAP1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mlao04147]     141514920 (RAP1B)    04031 GTP-binding proteins [BR:mlao04031]     141514920 (RAP1B) Exosome [BR:mlao04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    141514920 (RAP1B)   Exosomal proteins of other body fluids (saliva and urine)    141514920 (RAP1B)   Exosomal proteins of colorectal cancer cells    141514920 (RAP1B) GTP-binding proteins [BR:mlao04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     141514920 (RAP1B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha Motif Other DBs NCBI-GeneID:  141514920 NCBI-ProteinID:  XP_074082193 LinkDB All DBs Position 2:263655536..263715930 Genome browser AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSS CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgaatacaagctagttgtccttggctcaggaggtgttggaaagtctgccctgact gtacagtttgttcaaggaatatttgttgaaaaatatgatcctacaatagaagattcatat agaaagcaagttgaagtagatgctcaacaatgcatgctcgaaatcttggacactgcagga acggaacaatttacagcaatgagagatttatacatgaaaaatggacaaggctttgcatta gtctactccatcacagcacagtctacgtttaatgatttgcaagatctccgagaacagata cttcgagttaaagacactgacgatgtgccaatgattcttgtgggtaataagtgtgatttg gaagatgaaagagttgtaggaaaagaacaaggacagaacctagcaagacaatggaacaac tgtgcattcttagaatcttctgctaaatcaaagataaacgttaatgagatcttttatgac ctagtccggcaaattaacagaaaaactccagtacctgggaaggcacgtaaaaagtcctcg tgtcagttgctttaa

DBGET integrated database retrieval system