Macrotis lagotis (bilby): 141522331 Help Entry 141522331         CDS       T11097                                  Symbol FOS Name (RefSeq) protein c-Fos   KO K04379   proto-oncogene protein c-fos Organism mlao  Macrotis lagotis (bilby) Pathway mlao01522   Endocrine resistance mlao04010   MAPK signaling pathway mlao04024   cAMP signaling pathway mlao04210   Apoptosis mlao04380   Osteoclast differentiation mlao04620   Toll-like receptor signaling pathway mlao04657   IL-17 signaling pathway mlao04658   Th1 and Th2 cell differentiation mlao04659   Th17 cell differentiation mlao04660   T cell receptor signaling pathway mlao04662   B cell receptor signaling pathway mlao04668   TNF signaling pathway mlao04713   Circadian entrainment mlao04725   Cholinergic synapse mlao04728   Dopaminergic synapse mlao04915   Estrogen signaling pathway mlao04917   Prolactin signaling pathway mlao04921   Oxytocin signaling pathway mlao04926   Relaxin signaling pathway mlao04928   Parathyroid hormone synthesis, secretion and action mlao04932   Non-alcoholic fatty liver disease mlao04935   Growth hormone synthesis, secretion and action mlao05031   Amphetamine addiction mlao05132   Salmonella infection mlao05133   Pertussis mlao05135   Yersinia infection mlao05140   Leishmaniasis mlao05142   Chagas disease mlao05161   Hepatitis B mlao05162   Measles mlao05166   Human T-cell leukemia virus 1 infection mlao05167   Kaposi sarcoma-associated herpesvirus infection mlao05170   Human immunodeficiency virus 1 infection mlao05171   Coronavirus disease mlao05200   Pathways in cancer mlao05207   Chemical carcinogenesis - receptor activation mlao05208   Chemical carcinogenesis - reactive oxygen species mlao05210   Colorectal cancer mlao05224   Breast cancer mlao05231   Choline metabolism in cancer mlao05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mlao05323   Rheumatoid arthritis mlao05417   Lipid and atherosclerosis mlao05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mlao00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     141522331 (FOS)    04668 TNF signaling pathway     141522331 (FOS)    04024 cAMP signaling pathway     141522331 (FOS)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     141522331 (FOS)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     141522331 (FOS)    04660 T cell receptor signaling pathway     141522331 (FOS)    04658 Th1 and Th2 cell differentiation     141522331 (FOS)    04659 Th17 cell differentiation     141522331 (FOS)    04657 IL-17 signaling pathway     141522331 (FOS)    04662 B cell receptor signaling pathway     141522331 (FOS)   09152 Endocrine system    04915 Estrogen signaling pathway     141522331 (FOS)    04917 Prolactin signaling pathway     141522331 (FOS)    04921 Oxytocin signaling pathway     141522331 (FOS)    04926 Relaxin signaling pathway     141522331 (FOS)    04935 Growth hormone synthesis, secretion and action     141522331 (FOS)    04928 Parathyroid hormone synthesis, secretion and action     141522331 (FOS)   09156 Nervous system    04725 Cholinergic synapse     141522331 (FOS)    04728 Dopaminergic synapse     141522331 (FOS)   09158 Development and regeneration    04380 Osteoclast differentiation     141522331 (FOS)   09159 Environmental adaptation    04713 Circadian entrainment     141522331 (FOS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     141522331 (FOS)    05207 Chemical carcinogenesis - receptor activation     141522331 (FOS)    05208 Chemical carcinogenesis - reactive oxygen species     141522331 (FOS)    05231 Choline metabolism in cancer     141522331 (FOS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     141522331 (FOS)   09162 Cancer: specific types    05210 Colorectal cancer     141522331 (FOS)    05224 Breast cancer     141522331 (FOS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     141522331 (FOS)    05170 Human immunodeficiency virus 1 infection     141522331 (FOS)    05161 Hepatitis B     141522331 (FOS)    05171 Coronavirus disease     141522331 (FOS)    05162 Measles     141522331 (FOS)    05167 Kaposi sarcoma-associated herpesvirus infection     141522331 (FOS)   09171 Infectious disease: bacterial    05132 Salmonella infection     141522331 (FOS)    05135 Yersinia infection     141522331 (FOS)    05133 Pertussis     141522331 (FOS)   09174 Infectious disease: parasitic    05140 Leishmaniasis     141522331 (FOS)    05142 Chagas disease     141522331 (FOS)   09163 Immune disease    05323 Rheumatoid arthritis     141522331 (FOS)   09165 Substance dependence    05031 Amphetamine addiction     141522331 (FOS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     141522331 (FOS)    05418 Fluid shear stress and atherosclerosis     141522331 (FOS)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     141522331 (FOS)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     141522331 (FOS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:mlao03000]     141522331 (FOS)    04131 Membrane trafficking [BR:mlao04131]     141522331 (FOS) Transcription factors [BR:mlao03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     141522331 (FOS) Membrane trafficking [BR:mlao04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     141522331 (FOS) SSDB OrthologParalogGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf CCDC110 DUF3450 HALZ DUF4407 Macoilin GET2 Motif Other DBs NCBI-GeneID:  141522331 NCBI-ProteinID:  XP_074091795 LinkDB All DBs Position 4:complement(249314673..249319361) Genome browser AA seq 377 aa AA seqDB search MMYPGFNAEYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNSQDFCTDLAVSSANF IPTVTAISTSPDLQWLVQPTLISSVAPSQTRVHPYGVSTPSAAVYSRAGIVKTTGGRGQS IGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTE IANLLKEKEKLEFILAAHRPACKIPDDLGFPEEITAASLDLTGLTEAATPESEEAFSLPL LQETEPKPSVEPVKNINSLELKAEPFDDFLFPTSSRPGGLESAARSVPDMDLAGSFYAAD WEPLHSSSLGMGLAADLEPLCTPVVTCTPTCTTYTSSFVFTYPEADSFPSCAAAHRKGSS SNEPSSDSLSSPTLLAL NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt atgatgtacccaggattcaacgccgaatacgaagcatcctcctcccgatgcagcagtgct tccccggccggggacagcctgtcttattaccactccccggctgactccttctccagcatg ggctctcctgtcaactcacaggatttctgcacagatctggctgtttccagtgccaatttt ataccgactgtgacagctatatctacaagcccagacctgcagtggctggtccagcccacc ctcatctcttctgtagccccatcccagaccagagtccatccttatggagtctctactcct tcagctgctgtttactctagggctggcattgtgaagactacaggaggcagagggcaaagc attggcaggaggggcaaagttgagcagctttcccctgaagaagaggagaaaagaaggatc cggagagaaaggaacaaaatggctgcagccaaatgtcgaaacagaaggagagaactgact gacactctccaagcggagacagaccaactagaagatgaaaaatctgctctgcaaaccgag atagccaatctgctgaaggagaaggaaaaacttgaattcatcctagctgcccatcgacct gcctgcaagatccctgatgatttgggcttcccagaagaaataacagctgcctcccttgac ctcactggcctgactgaggctgcaactccagaatcagaggaagccttctccttgcccctc ttgcaggagactgaacccaaaccctctgtggagccagtcaagaacatcaacagtttggag ctgaaggccgagccctttgatgacttcctcttcccaacttcctcaaggcctggtggttta gaatctgcagcacgctcagtgcctgacatggacttggctggttccttctatgcagcagac tgggagcctctgcatagcagttccttggggatgggattagcagctgacctagagccactg tgcacccctgtggtcacctgcacacctacctgcaccacctatacgtcttccttcgtcttc acctacccagaggctgactccttccccagctgtgcggcagctcaccggaagggcagcagc agcaacgagccctcttctgactcactcagctccccaaccctgctagctttgtga

DBGET integrated database retrieval system