KEGG   Mandrillus leucophaeus (drill): 105530027
Entry
105530027         CDS       T08763                                 
Symbol
MAP2K2
Name
(RefSeq) dual specificity mitogen-activated protein kinase kinase 2
  KO
K04369  mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
mleu  Mandrillus leucophaeus (drill)
Pathway
mleu01521  EGFR tyrosine kinase inhibitor resistance
mleu01522  Endocrine resistance
mleu04010  MAPK signaling pathway
mleu04012  ErbB signaling pathway
mleu04014  Ras signaling pathway
mleu04015  Rap1 signaling pathway
mleu04022  cGMP-PKG signaling pathway
mleu04024  cAMP signaling pathway
mleu04066  HIF-1 signaling pathway
mleu04068  FoxO signaling pathway
mleu04071  Sphingolipid signaling pathway
mleu04072  Phospholipase D signaling pathway
mleu04140  Autophagy - animal
mleu04148  Efferocytosis
mleu04150  mTOR signaling pathway
mleu04151  PI3K-Akt signaling pathway
mleu04210  Apoptosis
mleu04218  Cellular senescence
mleu04270  Vascular smooth muscle contraction
mleu04370  VEGF signaling pathway
mleu04371  Apelin signaling pathway
mleu04540  Gap junction
mleu04550  Signaling pathways regulating pluripotency of stem cells
mleu04613  Neutrophil extracellular trap formation
mleu04620  Toll-like receptor signaling pathway
mleu04650  Natural killer cell mediated cytotoxicity
mleu04660  T cell receptor signaling pathway
mleu04662  B cell receptor signaling pathway
mleu04664  Fc epsilon RI signaling pathway
mleu04720  Long-term potentiation
mleu04722  Neurotrophin signaling pathway
mleu04730  Long-term depression
mleu04810  Regulation of actin cytoskeleton
mleu04910  Insulin signaling pathway
mleu04912  GnRH signaling pathway
mleu04915  Estrogen signaling pathway
mleu04916  Melanogenesis
mleu04917  Prolactin signaling pathway
mleu04919  Thyroid hormone signaling pathway
mleu04921  Oxytocin signaling pathway
mleu04926  Relaxin signaling pathway
mleu04929  GnRH secretion
mleu04934  Cushing syndrome
mleu04935  Growth hormone synthesis, secretion and action
mleu05010  Alzheimer disease
mleu05022  Pathways of neurodegeneration - multiple diseases
mleu05132  Salmonella infection
mleu05135  Yersinia infection
mleu05160  Hepatitis C
mleu05161  Hepatitis B
mleu05163  Human cytomegalovirus infection
mleu05164  Influenza A
mleu05165  Human papillomavirus infection
mleu05166  Human T-cell leukemia virus 1 infection
mleu05167  Kaposi sarcoma-associated herpesvirus infection
mleu05170  Human immunodeficiency virus 1 infection
mleu05200  Pathways in cancer
mleu05205  Proteoglycans in cancer
mleu05206  MicroRNAs in cancer
mleu05207  Chemical carcinogenesis - receptor activation
mleu05208  Chemical carcinogenesis - reactive oxygen species
mleu05210  Colorectal cancer
mleu05211  Renal cell carcinoma
mleu05213  Endometrial cancer
mleu05214  Glioma
mleu05215  Prostate cancer
mleu05216  Thyroid cancer
mleu05218  Melanoma
mleu05219  Bladder cancer
mleu05220  Chronic myeloid leukemia
mleu05221  Acute myeloid leukemia
mleu05223  Non-small cell lung cancer
mleu05224  Breast cancer
mleu05225  Hepatocellular carcinoma
mleu05226  Gastric cancer
mleu05230  Central carbon metabolism in cancer
mleu05231  Choline metabolism in cancer
mleu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mleu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105530027 (MAP2K2)
   04012 ErbB signaling pathway
    105530027 (MAP2K2)
   04014 Ras signaling pathway
    105530027 (MAP2K2)
   04015 Rap1 signaling pathway
    105530027 (MAP2K2)
   04370 VEGF signaling pathway
    105530027 (MAP2K2)
   04371 Apelin signaling pathway
    105530027 (MAP2K2)
   04066 HIF-1 signaling pathway
    105530027 (MAP2K2)
   04068 FoxO signaling pathway
    105530027 (MAP2K2)
   04072 Phospholipase D signaling pathway
    105530027 (MAP2K2)
   04071 Sphingolipid signaling pathway
    105530027 (MAP2K2)
   04024 cAMP signaling pathway
    105530027 (MAP2K2)
   04022 cGMP-PKG signaling pathway
    105530027 (MAP2K2)
   04151 PI3K-Akt signaling pathway
    105530027 (MAP2K2)
   04150 mTOR signaling pathway
    105530027 (MAP2K2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105530027 (MAP2K2)
   04148 Efferocytosis
    105530027 (MAP2K2)
  09143 Cell growth and death
   04210 Apoptosis
    105530027 (MAP2K2)
   04218 Cellular senescence
    105530027 (MAP2K2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    105530027 (MAP2K2)
   04550 Signaling pathways regulating pluripotency of stem cells
    105530027 (MAP2K2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105530027 (MAP2K2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    105530027 (MAP2K2)
   04620 Toll-like receptor signaling pathway
    105530027 (MAP2K2)
   04650 Natural killer cell mediated cytotoxicity
    105530027 (MAP2K2)
   04660 T cell receptor signaling pathway
    105530027 (MAP2K2)
   04662 B cell receptor signaling pathway
    105530027 (MAP2K2)
   04664 Fc epsilon RI signaling pathway
    105530027 (MAP2K2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    105530027 (MAP2K2)
   04929 GnRH secretion
    105530027 (MAP2K2)
   04912 GnRH signaling pathway
    105530027 (MAP2K2)
   04915 Estrogen signaling pathway
    105530027 (MAP2K2)
   04917 Prolactin signaling pathway
    105530027 (MAP2K2)
   04921 Oxytocin signaling pathway
    105530027 (MAP2K2)
   04926 Relaxin signaling pathway
    105530027 (MAP2K2)
   04935 Growth hormone synthesis, secretion and action
    105530027 (MAP2K2)
   04919 Thyroid hormone signaling pathway
    105530027 (MAP2K2)
   04916 Melanogenesis
    105530027 (MAP2K2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    105530027 (MAP2K2)
  09156 Nervous system
   04720 Long-term potentiation
    105530027 (MAP2K2)
   04730 Long-term depression
    105530027 (MAP2K2)
   04722 Neurotrophin signaling pathway
    105530027 (MAP2K2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105530027 (MAP2K2)
   05206 MicroRNAs in cancer
    105530027 (MAP2K2)
   05205 Proteoglycans in cancer
    105530027 (MAP2K2)
   05207 Chemical carcinogenesis - receptor activation
    105530027 (MAP2K2)
   05208 Chemical carcinogenesis - reactive oxygen species
    105530027 (MAP2K2)
   05230 Central carbon metabolism in cancer
    105530027 (MAP2K2)
   05231 Choline metabolism in cancer
    105530027 (MAP2K2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    105530027 (MAP2K2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105530027 (MAP2K2)
   05225 Hepatocellular carcinoma
    105530027 (MAP2K2)
   05226 Gastric cancer
    105530027 (MAP2K2)
   05214 Glioma
    105530027 (MAP2K2)
   05216 Thyroid cancer
    105530027 (MAP2K2)
   05221 Acute myeloid leukemia
    105530027 (MAP2K2)
   05220 Chronic myeloid leukemia
    105530027 (MAP2K2)
   05218 Melanoma
    105530027 (MAP2K2)
   05211 Renal cell carcinoma
    105530027 (MAP2K2)
   05219 Bladder cancer
    105530027 (MAP2K2)
   05215 Prostate cancer
    105530027 (MAP2K2)
   05213 Endometrial cancer
    105530027 (MAP2K2)
   05224 Breast cancer
    105530027 (MAP2K2)
   05223 Non-small cell lung cancer
    105530027 (MAP2K2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105530027 (MAP2K2)
   05170 Human immunodeficiency virus 1 infection
    105530027 (MAP2K2)
   05161 Hepatitis B
    105530027 (MAP2K2)
   05160 Hepatitis C
    105530027 (MAP2K2)
   05164 Influenza A
    105530027 (MAP2K2)
   05163 Human cytomegalovirus infection
    105530027 (MAP2K2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    105530027 (MAP2K2)
   05165 Human papillomavirus infection
    105530027 (MAP2K2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    105530027 (MAP2K2)
   05135 Yersinia infection
    105530027 (MAP2K2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105530027 (MAP2K2)
   05022 Pathways of neurodegeneration - multiple diseases
    105530027 (MAP2K2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105530027 (MAP2K2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    105530027 (MAP2K2)
   01522 Endocrine resistance
    105530027 (MAP2K2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mleu01001]
    105530027 (MAP2K2)
Enzymes [BR:mleu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     105530027 (MAP2K2)
Protein kinases [BR:mleu01001]
 Serine/threonine kinases: STE group
  STE7 family
   105530027 (MAP2K2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Pkinase_fungal Kinase-like Haspin_kinase Seadorna_VP7 APH
Other DBs
NCBI-GeneID: 105530027
NCBI-ProteinID: XP_011822741
LinkDB
Position
Unknown
AA seq 254 aa
MEHMDGGSLDQVLKEAKRIPEEILGKVSIAVLRGLAYLREKHQIMHRDVKPSNILVNSRG
EIKLCDFGVSGQLIDSMANSFVGTRSYMAPERLQGTHYSVQSDVWSMGLSLVELAIGRYP
IPPPDAKELEAIFGRPVVDGEEGEPHSISPRPRPPGRPISGHGMDSRPAMAIFELLDYIV
NEPPPKLPNGVFTPDFQEFVNKCLIKNPAERADLKMLTNHIFIKRSEVEEVDFAGWLCKT
LRLNQPGTPTRTAV
NT seq 765 nt   +upstreamnt  +downstreamnt
atggagcacatggatggcggctccctggaccaggtgctgaaggaggccaagaggatcccc
gaggagatcctggggaaagtcagcattgcggttctccggggcttggcgtatctccgagag
aagcaccagatcatgcaccgagatgtgaagccctccaacatccttgtaaactccagaggg
gagatcaagctgtgtgacttcggggtgagcggccagctcatcgactccatggccaactcc
ttcgtgggcacacgctcctacatggctccggagcggttgcagggcacacattactcggtg
cagtcggacgtctggagcatgggcctgtccctggtggagctggccatcggaaggtacccc
atccccccgcccgacgccaaggagctggaggccatctttggccggccagtggtcgacggg
gaagaaggagagcctcacagcatctcgcctcggccgagaccccccgggcgccccatcagc
ggtcacgggatggatagccggcccgccatggccatcttcgaactgctggactatattgtg
aatgagccgcctcctaagctgcccaacggtgtgttcacccccgacttccaggagtttgtc
aataaatgcctcatcaagaacccagcggagcgggcggacctgaagatgctcacgaaccac
atcttcatcaagcggtccgaggtggaagaagtggattttgccgggtggttgtgtaaaacc
ctgcgactgaaccagcctggcacacccacgcgcaccgccgtgtga

DBGET integrated database retrieval system