Mandrillus leucophaeus (drill): 105540805 Help Entry 105540805         CDS       T08763                                  Symbol FOS Name (RefSeq) proto-oncogene c-Fos isoform X1   KO K04379   proto-oncogene protein c-fos Organism mleu  Mandrillus leucophaeus (drill) Pathway mleu01522   Endocrine resistance mleu04010   MAPK signaling pathway mleu04024   cAMP signaling pathway mleu04210   Apoptosis mleu04380   Osteoclast differentiation mleu04620   Toll-like receptor signaling pathway mleu04657   IL-17 signaling pathway mleu04658   Th1 and Th2 cell differentiation mleu04659   Th17 cell differentiation mleu04660   T cell receptor signaling pathway mleu04662   B cell receptor signaling pathway mleu04668   TNF signaling pathway mleu04713   Circadian entrainment mleu04725   Cholinergic synapse mleu04728   Dopaminergic synapse mleu04915   Estrogen signaling pathway mleu04917   Prolactin signaling pathway mleu04921   Oxytocin signaling pathway mleu04926   Relaxin signaling pathway mleu04928   Parathyroid hormone synthesis, secretion and action mleu04932   Non-alcoholic fatty liver disease mleu04935   Growth hormone synthesis, secretion and action mleu05031   Amphetamine addiction mleu05132   Salmonella infection mleu05133   Pertussis mleu05135   Yersinia infection mleu05140   Leishmaniasis mleu05142   Chagas disease mleu05161   Hepatitis B mleu05162   Measles mleu05166   Human T-cell leukemia virus 1 infection mleu05167   Kaposi sarcoma-associated herpesvirus infection mleu05170   Human immunodeficiency virus 1 infection mleu05171   Coronavirus disease - COVID-19 mleu05200   Pathways in cancer mleu05207   Chemical carcinogenesis - receptor activation mleu05208   Chemical carcinogenesis - reactive oxygen species mleu05210   Colorectal cancer mleu05224   Breast cancer mleu05231   Choline metabolism in cancer mleu05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mleu05323   Rheumatoid arthritis mleu05417   Lipid and atherosclerosis mleu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mleu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105540805 (FOS)    04668 TNF signaling pathway     105540805 (FOS)    04024 cAMP signaling pathway     105540805 (FOS)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     105540805 (FOS)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105540805 (FOS)    04660 T cell receptor signaling pathway     105540805 (FOS)    04658 Th1 and Th2 cell differentiation     105540805 (FOS)    04659 Th17 cell differentiation     105540805 (FOS)    04657 IL-17 signaling pathway     105540805 (FOS)    04662 B cell receptor signaling pathway     105540805 (FOS)   09152 Endocrine system    04915 Estrogen signaling pathway     105540805 (FOS)    04917 Prolactin signaling pathway     105540805 (FOS)    04921 Oxytocin signaling pathway     105540805 (FOS)    04926 Relaxin signaling pathway     105540805 (FOS)    04935 Growth hormone synthesis, secretion and action     105540805 (FOS)    04928 Parathyroid hormone synthesis, secretion and action     105540805 (FOS)   09156 Nervous system    04725 Cholinergic synapse     105540805 (FOS)    04728 Dopaminergic synapse     105540805 (FOS)   09158 Development and regeneration    04380 Osteoclast differentiation     105540805 (FOS)   09159 Environmental adaptation    04713 Circadian entrainment     105540805 (FOS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105540805 (FOS)    05207 Chemical carcinogenesis - receptor activation     105540805 (FOS)    05208 Chemical carcinogenesis - reactive oxygen species     105540805 (FOS)    05231 Choline metabolism in cancer     105540805 (FOS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     105540805 (FOS)   09162 Cancer: specific types    05210 Colorectal cancer     105540805 (FOS)    05224 Breast cancer     105540805 (FOS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     105540805 (FOS)    05170 Human immunodeficiency virus 1 infection     105540805 (FOS)    05161 Hepatitis B     105540805 (FOS)    05171 Coronavirus disease - COVID-19     105540805 (FOS)    05162 Measles     105540805 (FOS)    05167 Kaposi sarcoma-associated herpesvirus infection     105540805 (FOS)   09171 Infectious disease: bacterial    05132 Salmonella infection     105540805 (FOS)    05135 Yersinia infection     105540805 (FOS)    05133 Pertussis     105540805 (FOS)   09174 Infectious disease: parasitic    05140 Leishmaniasis     105540805 (FOS)    05142 Chagas disease     105540805 (FOS)   09163 Immune disease    05323 Rheumatoid arthritis     105540805 (FOS)   09165 Substance dependence    05031 Amphetamine addiction     105540805 (FOS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105540805 (FOS)    05418 Fluid shear stress and atherosclerosis     105540805 (FOS)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     105540805 (FOS)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     105540805 (FOS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:mleu03000]     105540805 (FOS)    04131 Membrane trafficking [BR:mleu04131]     105540805 (FOS) Transcription factors [BR:mleu03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     105540805 (FOS) Membrane trafficking [BR:mleu04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     105540805 (FOS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 HALZ Macoilin Motif Other DBs NCBI-GeneID:  105540805 NCBI-ProteinID:  XP_011836946 Ensembl:  ENSMLEG00000040559 UniProt:  A0A2K5ZY15 LinkDB All DBs Position Unknown AA seq 380 aa AA seqDB search MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF IPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPTPSAGAYSRAGIVKTMTGSRA QSTGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEAATPESEEAFT LPLLNDPEPKPSVEPVKSISSMELKAEPFDDFLFPASTRPSGSETARSVPDMDLSGSFYA ADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRK GSSSNEPSSDSLSSPTLLAL NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt atgatgttctcgggcttcaacgcagactacgaggcgtcatcctcgcgctgcagcagcgcg tccccggccggggatagcctctcctactaccactcacccgccgattccttctccagcatg ggctcgcctgtcaacgcgcaggacttctgcacggacctggccgtctccagtgccaacttc attcccacggtcactgccatctcgaccagtccggacctgcagtggcttgtgcagcccgcc ctcgtctcctctgtggccccatcgcagaccagagcccctcaccccttcggagtccccact ccctccgctggggcttactccagggctggcattgtgaagaccatgacaggaagccgagcg cagagcactggcaggaggggcaaggtggaacagttatctccagaagaagaagagaaaagg agaatccgaagggaaaggaataagatggctgcagccaaatgccgcaaccggaggagggag ctgactgatacactccaagcggagacagaccaactagaagatgagaagtctgctttgcag accgagattgccaacctgctgaaggagaaggaaaaactagaattcatcctggcagctcac cgacctgcctgcaagatccctgatgacctgggctttccagaagagatgtctgtggcttcc cttgatctgactgggggcctgccagaggctgccaccccagagtctgaggaggccttcacc ctgcctctcctcaatgacccagagcccaagccctcagtggagcctgtcaagagcatcagc agcatggagctgaaggctgagccctttgatgacttcctgttcccagcatcaaccaggccc agcggctctgagacagcccgctctgtaccagacatggacctatctgggtccttctatgca gcagactgggagcccctgcacagtggctccctggggatggggcccatggccacagagctg gagcccctgtgcactccggtggttacctgtactcccagctgcactgcttacacgtcttcc ttcgtcttcacctaccccgaggctgactccttccccagctgcgcagctgcccaccgcaag ggcagcagcagcaatgagccctcctctgactcgctcagctcacccacgctgctggccctg tga

DBGET integrated database retrieval system