Mandrillus leucophaeus (drill): 105545746 Help Entry 105545746         CDS       T08763                                  Symbol IFNB1 Name (RefSeq) interferon beta   KO K05415   interferon beta Organism mleu  Mandrillus leucophaeus (drill) Pathway mleu04060   Cytokine-cytokine receptor interaction mleu04151   PI3K-Akt signaling pathway mleu04217   Necroptosis mleu04380   Osteoclast differentiation mleu04620   Toll-like receptor signaling pathway mleu04621   NOD-like receptor signaling pathway mleu04622   RIG-I-like receptor signaling pathway mleu04623   Cytosolic DNA-sensing pathway mleu04630   JAK-STAT signaling pathway mleu04650   Natural killer cell mediated cytotoxicity mleu04668   TNF signaling pathway mleu04936   Alcoholic liver disease mleu05135   Yersinia infection mleu05142   Chagas disease mleu05152   Tuberculosis mleu05160   Hepatitis C mleu05161   Hepatitis B mleu05162   Measles mleu05163   Human cytomegalovirus infection mleu05164   Influenza A mleu05165   Human papillomavirus infection mleu05167   Kaposi sarcoma-associated herpesvirus infection mleu05168   Herpes simplex virus 1 infection mleu05169   Epstein-Barr virus infection mleu05170   Human immunodeficiency virus 1 infection mleu05171   Coronavirus disease - COVID-19 mleu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mleu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     105545746 (IFNB1)    04668 TNF signaling pathway     105545746 (IFNB1)    04151 PI3K-Akt signaling pathway     105545746 (IFNB1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105545746 (IFNB1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     105545746 (IFNB1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105545746 (IFNB1)    04621 NOD-like receptor signaling pathway     105545746 (IFNB1)    04622 RIG-I-like receptor signaling pathway     105545746 (IFNB1)    04623 Cytosolic DNA-sensing pathway     105545746 (IFNB1)    04650 Natural killer cell mediated cytotoxicity     105545746 (IFNB1)   09158 Development and regeneration    04380 Osteoclast differentiation     105545746 (IFNB1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     105545746 (IFNB1)    05161 Hepatitis B     105545746 (IFNB1)    05160 Hepatitis C     105545746 (IFNB1)    05171 Coronavirus disease - COVID-19     105545746 (IFNB1)    05164 Influenza A     105545746 (IFNB1)    05162 Measles     105545746 (IFNB1)    05168 Herpes simplex virus 1 infection     105545746 (IFNB1)    05163 Human cytomegalovirus infection     105545746 (IFNB1)    05167 Kaposi sarcoma-associated herpesvirus infection     105545746 (IFNB1)    05169 Epstein-Barr virus infection     105545746 (IFNB1)    05165 Human papillomavirus infection     105545746 (IFNB1)   09171 Infectious disease: bacterial    05135 Yersinia infection     105545746 (IFNB1)    05152 Tuberculosis     105545746 (IFNB1)   09174 Infectious disease: parasitic    05142 Chagas disease     105545746 (IFNB1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105545746 (IFNB1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     105545746 (IFNB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mleu04052]     105545746 (IFNB1) Cytokines and neuropeptides [BR:mleu04052]  Cytokines   Interferons    105545746 (IFNB1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  105545746 NCBI-ProteinID:  XP_011844158 LinkDB All DBs Position Unknown AA seq 187 aa AA seqDB search MTNKCLLQIALLLCFSTTALSMSYNLLGFLQRSSSFQCQKLLWQLNGRLEYCLKDRMNFD IPEEIKQPQHFQKEDAALTIYEMLQNIFAIFRQDLSSTGWNETTVENLLANVYHQIDHLK TILEEKLEKEDFTRGKFMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFFFINK LTGYLRN NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atgaccaacaagtgtctcctccaaattgctctcctgttgtgcttctccactacggctctt tccatgagctacaacttgcttggattcctacaaagaagcagcagttttcagtgtcagaag ctcctgtggcaattgaatggaaggcttgaatattgcctcaaggacaggatgaactttgac atccctgaggaaattaagcagccacagcacttccagaaggaggacgctgcattgaccatc tatgagatgctccagaacatctttgctattttcagacaagatttatctagcactggctgg aatgagactactgtggagaacctccttgctaatgtctatcatcagatagaccatctgaag acaatcctagaagaaaaactggagaaagaagatttcaccaggggaaaattcatgagcagt ctgcacctgaaaagatactatggaaggattctgcattacctgaaggccaaggagtacagt cactgtgcctggaccatagtcagagtggaaatcctcagaaactttttcttcattaacaaa cttacaggttacctccgaaactga

DBGET integrated database retrieval system