Mandrillus leucophaeus (drill): 105551374 Help Entry 105551374         CDS       T08763                                  Symbol NPPA Name (RefSeq) natriuretic peptides A   KO K12334   natriuretic peptide A Organism mleu  Mandrillus leucophaeus (drill) Pathway mleu04022   cGMP-PKG signaling pathway mleu04024   cAMP signaling pathway mleu04066   HIF-1 signaling pathway mleu04081   Hormone signaling mleu04270   Vascular smooth muscle contraction mleu04714   Thermogenesis mleu04921   Oxytocin signaling pathway mleu04923   Regulation of lipolysis in adipocytes mleu04924   Renin secretion mleu04925   Aldosterone synthesis and secretion mleu05143   African trypanosomiasis Brite KEGG Orthology (KO) [BR:mleu00001]  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     105551374 (NPPA)    04024 cAMP signaling pathway     105551374 (NPPA)    04022 cGMP-PKG signaling pathway     105551374 (NPPA)   09133 Signaling molecules and interaction    04081 Hormone signaling     105551374 (NPPA)  09150 Organismal Systems   09152 Endocrine system    04923 Regulation of lipolysis in adipocytes     105551374 (NPPA)    04921 Oxytocin signaling pathway     105551374 (NPPA)    04924 Renin secretion     105551374 (NPPA)    04925 Aldosterone synthesis and secretion     105551374 (NPPA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     105551374 (NPPA)   09159 Environmental adaptation    04714 Thermogenesis     105551374 (NPPA)  09160 Human Diseases   09174 Infectious disease: parasitic    05143 African trypanosomiasis     105551374 (NPPA)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mleu04052]     105551374 (NPPA) Cytokines and neuropeptides [BR:mleu04052]  Neuropeptides   Unclassified    105551374 (NPPA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ANP Motif Other DBs NCBI-GeneID:  105551374 NCBI-ProteinID:  XP_011851970 Ensembl:  ENSMLEG00000034207 UniProt:  A0A2K5YWQ8 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search MSSFSTISVSFLLFLAFQLPGQTRANPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPP QVLREQNEEAGAALSPLPEVPPWTGDVSPAQRDGGALGQGPWDSSDRSALLKSKLRALLT APRSLRRSSCFGGRMDRIGAQSGLGCNSFRYRR NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgagctccttctccaccatcagcgtgagcttcctcctttttctggcattccagctccca ggtcagaccagagctaatcccatgtacaatgccgtgtccaacgcagacctgatggatttc aagaatttgctggaccatttggaagaaaagatgcctttagaagatgaggtcgtgccccca caagtgctcagagagcagaatgaagaagcgggggctgctctcagccccctccctgaggtg cctccctggaccggggatgtcagcccagcccagagagatgggggtgccctcgggcagggc ccctgggactcctccgatcgatctgccctcttaaaaagcaagctgagggcgctgctcact gcccctcggagcctgcggagatccagctgcttcgggggcaggatggacaggattggagcc cagagcggactgggctgtaacagcttccggtaccgaagataa

DBGET integrated database retrieval system