Myotis lucifugus (little brown bat): 102417209 Help Entry 102417209         CDS       T07795                                  Symbol IFNB1 Name (RefSeq) interferon beta   KO K05415   interferon beta Organism mlf  Myotis lucifugus (little brown bat) Pathway mlf04060   Cytokine-cytokine receptor interaction mlf04151   PI3K-Akt signaling pathway mlf04217   Necroptosis mlf04380   Osteoclast differentiation mlf04620   Toll-like receptor signaling pathway mlf04621   NOD-like receptor signaling pathway mlf04622   RIG-I-like receptor signaling pathway mlf04623   Cytosolic DNA-sensing pathway mlf04630   JAK-STAT signaling pathway mlf04650   Natural killer cell mediated cytotoxicity mlf04668   TNF signaling pathway mlf04936   Alcoholic liver disease mlf05135   Yersinia infection mlf05142   Chagas disease mlf05152   Tuberculosis mlf05160   Hepatitis C mlf05161   Hepatitis B mlf05162   Measles mlf05163   Human cytomegalovirus infection mlf05164   Influenza A mlf05165   Human papillomavirus infection mlf05167   Kaposi sarcoma-associated herpesvirus infection mlf05168   Herpes simplex virus 1 infection mlf05169   Epstein-Barr virus infection mlf05170   Human immunodeficiency virus 1 infection mlf05171   Coronavirus disease - COVID-19 mlf05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mlf00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102417209 (IFNB1)    04668 TNF signaling pathway     102417209 (IFNB1)    04151 PI3K-Akt signaling pathway     102417209 (IFNB1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102417209 (IFNB1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     102417209 (IFNB1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102417209 (IFNB1)    04621 NOD-like receptor signaling pathway     102417209 (IFNB1)    04622 RIG-I-like receptor signaling pathway     102417209 (IFNB1)    04623 Cytosolic DNA-sensing pathway     102417209 (IFNB1)    04650 Natural killer cell mediated cytotoxicity     102417209 (IFNB1)   09158 Development and regeneration    04380 Osteoclast differentiation     102417209 (IFNB1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102417209 (IFNB1)    05161 Hepatitis B     102417209 (IFNB1)    05160 Hepatitis C     102417209 (IFNB1)    05171 Coronavirus disease - COVID-19     102417209 (IFNB1)    05164 Influenza A     102417209 (IFNB1)    05162 Measles     102417209 (IFNB1)    05168 Herpes simplex virus 1 infection     102417209 (IFNB1)    05163 Human cytomegalovirus infection     102417209 (IFNB1)    05167 Kaposi sarcoma-associated herpesvirus infection     102417209 (IFNB1)    05169 Epstein-Barr virus infection     102417209 (IFNB1)    05165 Human papillomavirus infection     102417209 (IFNB1)   09171 Infectious disease: bacterial    05135 Yersinia infection     102417209 (IFNB1)    05152 Tuberculosis     102417209 (IFNB1)   09174 Infectious disease: parasitic    05142 Chagas disease     102417209 (IFNB1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102417209 (IFNB1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     102417209 (IFNB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mlf04052]     102417209 (IFNB1) Cytokines and neuropeptides [BR:mlf04052]  Cytokines   Interferons    102417209 (IFNB1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon UVB_sens_C KAR9 Motif Other DBs NCBI-GeneID:  102417209 NCBI-ProteinID:  XP_014319257 Ensembl:  ENSMLUG00000008021 UniProt:  G1Q950 LinkDB All DBs Position Unknown AA seq 186 aa AA seqDB search MTNRCTLQLTVLLCLTGAALSMNYGTLRFQQSSSNSACQKLLWQLITSPQHCLDDRMDFQ IPREVEQPQQVRKEEAMVVMHEMLQQIFSIFRRGFSNAGWNETIVENLLEELDGQMDRLE TALEEITKEGKFPWENRTVLRLKTYYLGIFQYLKGKSYSRCAWTVVQAEILRNFSFLNRL IGALQD NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgaccaacaggtgcaccctccagctcactgtcctgctgtgtctcaccggggccgcgctc tccatgaactatggcacgctccgcttccagcagagtagcagcaattcagcctgtcagaag ctcctgtggcagttaattacaagccctcagcattgcctggacgacaggatggacttccag atccccagggaggttgaacaaccacagcaggtccggaaggaggaagccatggtggtcatg cacgagatgctccagcagatcttcagcattttcagaagaggtttctccaacgctggctgg aatgagaccattgttgagaaccttctggaggagctcgatgggcagatggaccgcctggag acagccctggaggaaatcaccaaggagggaaagttcccctgggaaaacaggaccgtgctg cgcctgaagacctattacttaggcatcttccagtacctgaagggcaagtcctacagcaga tgtgcctggacagtagtccaagcggaaatcctcaggaacttttccttccttaatcgactt ataggtgccctccaggactga

DBGET integrated database retrieval system